Human ELOVL6/FACE/FAE ORF/cDNA clone-Lentivirus plasmid (NM_024090)

Cat. No.: pGMLP000904
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ELOVL6/FACE/FAE Lentiviral expression plasmid for ELOVL6 lentivirus packaging, ELOVL6 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to ELOVL6/FACE products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $499.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000904
Gene Name ELOVL6
Accession Number NM_024090
Gene ID 79071
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 798 bp
Gene Alias FACE,FAE,LCE
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAACATGTCAGTGTTGACTTTACAAGAATATGAATTCGAAAAGCAGTTCAACGAGAATGAAGCCATCCAATGGATGCAGGAAAACTGGAAGAAATCTTTCCTGTTTTCTGCTCTGTATGCTGCCTTTATATTCGGTGGTCGGCACCTAATGAATAAACGAGCAAAGTTTGAACTGAGGAAGCCATTAGTGCTCTGGTCTCTGACCCTTGCAGTCTTCAGTATATTCGGTGCTCTTCGAACTGGTGCTTATATGGTGTACATTTTGATGACCAAAGGCCTGAAGCAGTCAGTTTGTGACCAGGGTTTTTACAATGGACCTGTCAGCAAATTCTGGGCTTATGCATTTGTGCTAAGCAAAGCACCCGAACTAGGAGATACAATATTCATTATTCTGAGGAAGCAGAAGCTGATCTTCCTGCACTGGTATCACCACATCACTGTGCTCCTGTACTCTTGGTACTCCTACAAAGACATGGTTGCCGGGGGAGGTTGGTTCATGACTATGAACTATGGCGTGCACGCCGTGATGTACTCTTACTATGCCTTGCGGGCGGCAGGTTTCCGAGTCTCCCGGAAGTTTGCCATGTTCATCACCTTGTCCCAGATCACTCAGATGCTGATGGGCTGTGTGGTTAACTACCTGGTCTTCTGCTGGATGCAGCATGACCAGTGTCACTCTCACTTTCAGAACATCTTCTGGTCCTCACTCATGTACCTCAGCTACCTTGTGCTCTTCTGCCATTTCTTCTTTGAGGCCTACATCGGCAAAATGAGGAAAACAACGAAAGCTGAATAG
ORF Protein Sequence MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0750-Ab Anti-ELOVL6 monoclonal antibody
    Target Antigen GM-Tg-g-IP0750-Ag ELOVL6 protein
    ORF Viral Vector pGMLP000904 Human ELOVL6 Lentivirus plasmid
    ORF Viral Vector vGMLP000904 Human ELOVL6 Lentivirus particle


    Target information

    Target ID GM-IP0750
    Target Name ELOVL6
    Gene Group Identifier
    (Target Gene ID in Homo species)
    79071
    Gene ID 100072829 (Equus caballus), 101082563 (Felis catus), 170439 (Mus musculus), 171402 (Rattus norvegicus)
    487900 (Canis lupus familiaris), 533333 (Bos taurus), 698870 (Macaca mulatta), 79071 (Homo sapiens)
    Gene Symbols & Synonyms ELOVL6,Elovl6,FAE,LCE,Lce2,rELO2,FACE,hELO2
    Target Alternative Names ELOVL6,Very long chain fatty acid elongase 6,3-keto acyl-CoA synthase ELOVL6, ELOVL fatty acid elongase 6 (ELOVL FA elongase 6), Elongation of very long chain fatty acids protein 6, Fatty acid elongase 2 (hELO2), Fatty acyl-CoA elongase, Long-chain fatty-acyl elongase, Very long chain 3-ketoacyl-CoA synthase 6, Very long chain 3-oxoacyl-CoA synthase 6,FAE,LCE,FACE,hELO2
    Uniprot Accession Q920L5,Q920L6,Q9H5J4
    Additional SwissProt Accessions: Q920L5,Q920L6,Q9H5J4
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG Metabolic pathways
    Gene Ensembl ENSECAG00000010720, ENSMUSG00000041220, ENSCAFG00845030224, ENSBTAG00000010564, ENSMMUG00000050694, ENSG00000170522
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.