Human TNFRSF14/ATAR/CD270 ORF/cDNA clone-Lentivirus plasmid (NM_001297605)
Cat. No.: pGMLP000899
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human TNFRSF14/ATAR/CD270 Lentiviral expression plasmid for TNFRSF14 lentivirus packaging, TNFRSF14 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
HVEM/TNFRSF14/CD270/TNFRSF14/ATAR products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000899 |
| Gene Name | TNFRSF14 |
| Accession Number | NM_001297605 |
| Gene ID | 8764 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 555 bp |
| Gene Alias | ATAR,CD270,HVEA,HVEM,LIGHTR,TR2 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGAGCCTCCTGGAGACTGGGGGCCTCCTCCCTGGAGATCCACCCCCAAAACCGACGTCTTGAGGCTGGTGCTGTATCTCACCTTCCTGGGAGCCCCCTGCTACGCCCCAGCTCTGCCGTCCTGCAAGGAGGACGAGTACCCAGTGGGCTCCGAGTGCTGCCCCAAGTGCAGTCCAGGTTATCGTGTGAAGGAGGCCTGCGGGGAGCTGACGGGCACAGTGTGTGAACCCTGCCCTCCAGGCACCTACATTGCCCACCTCAATGGCCTAAGCAAGTGTCTGCAGTGCCAAATGTGTGACCCAGCCATGGGCCTGCGCGCGAGCCGGAACTGCTCCAGGACAGAGAACGCCGTGTGTGGCTGCAGCCCAGGCCACTTCTGCATCGTCCAGGACGGGGACCACTGCGCCGCGTGCCGCGCTTACGCCACCTCCAGCCCGGGCCAGAGGGTGCAGAAGGGAGGCACCGAGAGTCAGGACACCCTGTGTCAGAACTGCCCCCCGGGGACCTTCTCTCCCAATGGGACCCTGGAGGAATGTCAGCACCAGACCAAGTGA |
| ORF Protein Sequence | MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IO063-Ab | Anti-TNR14/ HVEM/ TNFRSF14 monoclonal antibody |
| Target Antigen | GM-Tg-g-IO063-Ag | HVEM/TNFRSF14 VLP (virus-like particle) |
| Cytokine | cks-Tg-g-GM-IO063 | tumor necrosis factor receptor superfamily, member 14 (TNFRSF14) protein & antibody |
| ORF Viral Vector | pGMLP000899 | Human TNFRSF14 Lentivirus plasmid |
| ORF Viral Vector | vGMLP000899 | Human TNFRSF14 Lentivirus particle |
Target information
| Target ID | GM-IO063 |
| Target Name | HVEM/TNFRSF14/CD270 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
8764 |
| Gene ID |
101089877 (Felis catus), 230979 (Mus musculus), 366518 (Rattus norvegicus), 479580 (Canis lupus familiaris) 695042 (Macaca mulatta), 8764 (Homo sapiens) |
| Gene Symbols & Synonyms | TNFRSF14,Tnfrsf14,TR2,Atar,HveA,Hvem,Tnfrs14,HVEM,ATAR,HVEA,CD270,LIGHTR |
| Target Alternative Names | ATAR,Atar,CD270,HVEA,HVEM,Herpes virus entry mediator A (Herpesvirus entry mediator A,HveA,HveA),Hvem,LIGHTR,TNFRSF14,TR2,Tnfrs14,Tnfrsf14,Tumor necrosis factor receptor superfamily member 14,Tumor necrosis factor receptor-like 2 (TR2) |
| Uniprot Accession |
Q80WM9,Q92956
Additional SwissProt Accessions: Q80WM9,Q92956 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Immuno-oncology Target, Cytokine Target |
| Disease | cancer |
| Disease from KEGG | Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor |
| Gene Ensembl | ENSMUSG00000042333, ENSMMUG00000016329, ENSG00000157873 |
| Target Classification | Checkpoint-Immuno Oncology |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


