Human TXN/TRDX/TRX ORF/cDNA clone-Lentivirus plasmid (NM_003329.3)
Cat. No.: pGMLP000876
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human TXN/TRDX/TRX Lentiviral expression plasmid for TXN lentivirus packaging, TXN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
Thioredoxin/TXN/TXN/TRDX products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP000876 |
Gene Name | TXN |
Accession Number | NM_003329.3 |
Gene ID | 7295 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 318 bp |
Gene Alias | TRDX,TRX,TRX1 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGTGAAGCAGATCGAGAGCAAGACTGCTTTTCAGGAAGCCTTGGACGCTGCAGGTGATAAACTTGTAGTAGTTGACTTCTCAGCCACGTGGTGTGGGCCTTGCAAAATGATCAAGCCTTTCTTTCATTCCCTCTCTGAAAAGTATTCCAACGTGATATTCCTTGAAGTAGATGTGGATGACTGTCAGGATGTTGCTTCAGAGTGTGAAGTCAAATGCATGCCAACATTCCAGTTTTTTAAGAAGGGACAAAAGGTGGGTGAATTTTCTGGAGCCAATAAGGAAAAGCTTGAAGCCACCATTAATGAATTAGTCTAA |
ORF Protein Sequence | MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T85616-Ab | Anti-THIO/ TXN/ TRDX functional antibody |
Target Antigen | GM-Tg-g-T85616-Ag | TXN protein |
ORF Viral Vector | pGMLP000876 | Human TXN Lentivirus plasmid |
ORF Viral Vector | pGMAD000153 | Human TXN Adenovirus plasmid |
ORF Viral Vector | pGMAAV000969 | Human TXN Adeno-associate virus(AAV) plasmid |
ORF Viral Vector | pGMAAV001719 | Human TXN Adeno-associate virus(AAV) plasmid |
ORF Viral Vector | pGMPC000200 | Human TXN1 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP000876 | Human TXN Lentivirus particle |
ORF Viral Vector | vGMAD000153 | Human TXN Adenovirus particle |
ORF Viral Vector | vGMAAV000969 | Human TXN Adeno-associate virus(AAV) particle |
ORF Viral Vector | vGMAAV001719 | Human TXN Adeno-associate virus(AAV) particle |
Target information
Target ID | GM-T85616 |
Target Name | Thioredoxin/TXN |
Gene Group Identifier (Target Gene ID in Homo species) |
7295 |
Gene ID |
100033827 (Equus caballus), 101090655 (Felis catus), 116484 (Rattus norvegicus), 22166 (Mus musculus) 280950 (Bos taurus), 474798 (Canis lupus familiaris), 712587 (Macaca mulatta), 7295 (Homo sapiens) |
Gene Symbols & Synonyms | TXN,Txn1,Txn,ADF,Trx1,Trx,TRX,TRDX,TRX1,TXN1,Trx80 |
Target Alternative Names | Thioredoxin, TXN,Thioredoxin,Trx,ATL-derived factor (ADF), Surface-associated sulphydryl protein (SASP),TRX,TRDX,TRX1,TXN1,Trx80 |
Uniprot Accession |
O97508,O97680,P10599,P10639,P11232,P29451,P99505
Additional SwissProt Accessions: O97508,P11232,P10639,O97680,P99505,P29451,P10599 |
Uniprot Entry Name | |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target |
Disease | |
Disease from KEGG | NOD-like receptor signaling pathway, Fluid shear stress and atherosclerosis |
Gene Ensembl | ENSECAG00000013324, ENSMUSG00000028367, ENSBTAG00000002953, ENSCAFG00845013183, ENSMMUG00000052156, ENSG00000136810 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.