Human TXN/TRDX/TRX ORF/cDNA clone-Lentivirus plasmid (NM_003329.3)

Cat. No.: pGMLP000876
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TXN/TRDX/TRX Lentiviral expression plasmid for TXN lentivirus packaging, TXN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to Thioredoxin/TXN/TXN/TRDX products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000876
Gene Name TXN
Accession Number NM_003329.3
Gene ID 7295
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 318 bp
Gene Alias TRDX,TRX,TRX1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTGAAGCAGATCGAGAGCAAGACTGCTTTTCAGGAAGCCTTGGACGCTGCAGGTGATAAACTTGTAGTAGTTGACTTCTCAGCCACGTGGTGTGGGCCTTGCAAAATGATCAAGCCTTTCTTTCATTCCCTCTCTGAAAAGTATTCCAACGTGATATTCCTTGAAGTAGATGTGGATGACTGTCAGGATGTTGCTTCAGAGTGTGAAGTCAAATGCATGCCAACATTCCAGTTTTTTAAGAAGGGACAAAAGGTGGGTGAATTTTCTGGAGCCAATAAGGAAAAGCTTGAAGCCACCATTAATGAATTAGTCTAA
ORF Protein Sequence MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T85616-Ab Anti-THIO/ TXN/ TRDX functional antibody
    Target Antigen GM-Tg-g-T85616-Ag TXN protein
    ORF Viral Vector pGMLP000876 Human TXN Lentivirus plasmid
    ORF Viral Vector pGMAD000153 Human TXN Adenovirus plasmid
    ORF Viral Vector pGMAAV000969 Human TXN Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAAV001719 Human TXN Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMPC000200 Human TXN1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000876 Human TXN Lentivirus particle
    ORF Viral Vector vGMAD000153 Human TXN Adenovirus particle
    ORF Viral Vector vGMAAV000969 Human TXN Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAAV001719 Human TXN Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-T85616
    Target Name Thioredoxin/TXN
    Gene Group Identifier
    (Target Gene ID in Homo species)
    7295
    Gene ID 100033827 (Equus caballus), 101090655 (Felis catus), 116484 (Rattus norvegicus), 22166 (Mus musculus)
    280950 (Bos taurus), 474798 (Canis lupus familiaris), 712587 (Macaca mulatta), 7295 (Homo sapiens)
    Gene Symbols & Synonyms TXN,Txn1,Txn,ADF,Trx1,Trx,TRX,TRDX,TRX1,TXN1,Trx80
    Target Alternative Names Thioredoxin, TXN,Thioredoxin,Trx,ATL-derived factor (ADF), Surface-associated sulphydryl protein (SASP),TRX,TRDX,TRX1,TXN1,Trx80
    Uniprot Accession O97508,O97680,P10599,P10639,P11232,P29451,P99505
    Additional SwissProt Accessions: O97508,P11232,P10639,O97680,P99505,P29451,P10599
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease
    Disease from KEGG NOD-like receptor signaling pathway, Fluid shear stress and atherosclerosis
    Gene Ensembl ENSECAG00000013324, ENSMUSG00000028367, ENSBTAG00000002953, ENSCAFG00845013183, ENSMMUG00000052156, ENSG00000136810
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.