Human PTN/HARP/HB-GAM ORF/cDNA clone-Lentivirus plasmid (NM_002825)

Cat. No.: pGMLP000869
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PTN/HARP/HB-GAM Lentiviral expression plasmid for PTN lentivirus packaging, PTN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to PTN/HARP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $426.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000869
Gene Name PTN
Accession Number NM_002825
Gene ID 5764
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 507 bp
Gene Alias HARP,HB-GAM,HBBM,HBGF-8,HBGF8,HBNF,HBNF-1,NEGF1,OSF-1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGGCTCAACAGTACCAGCAGCAGCGTCGAAAATTTGCAGCTGCCTTCTTGGCATTCATTTTCATACTGGCAGCTGTGGATACTGCTGAAGCAGGGAAGAAAGAGAAACCAGAAAAAAAAGTGAAGAAGTCTGACTGTGGAGAATGGCAGTGGAGTGTGTGTGTGCCCACCAGTGGAGACTGTGGGCTGGGCACACGGGAGGGCACTCGGACTGGAGCTGAGTGCAAGCAAACCATGAAGACCCAGAGATGTAAGATCCCCTGCAACTGGAAGAAGCAATTTGGCGCGGAGTGCAAATACCAGTTCCAGGCCTGGGGAGAATGTGACCTGAACACAGCCCTGAAGACCAGAACTGGAAGTCTGAAGCGAGCCCTGCACAATGCCGAATGCCAGAAGACTGTCACCATCTCCAAGCCCTGTGGCAAACTGACCAAGCCCAAACCTCAAGCAGAATCTAAGAAGAAGAAAAAGGAAGGCAAGAAACAGGAGAAGATGCTGGATTAA
ORF Protein Sequence MQAQQYQQQRRKFAAAFLAFIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T49522-Ab Anti-PTN/ HARP/ HB-GAM monoclonal antibody
    Target Antigen GM-Tg-g-T49522-Ag PTN VLP (virus-like particle)
    ORF Viral Vector pGMLP000869 Human PTN Lentivirus plasmid
    ORF Viral Vector pGMAD001512 Human PTN Adenovirus plasmid
    ORF Viral Vector vGMLP000869 Human PTN Lentivirus particle
    ORF Viral Vector vGMAD001512 Human PTN Adenovirus particle


    Target information

    Target ID GM-T49522
    Target Name PTN
    Gene Group Identifier
    (Target Gene ID in Homo species)
    5764
    Gene ID 100064880 (Equus caballus), 101100041 (Felis catus), 19242 (Mus musculus), 24924 (Rattus norvegicus)
    280904 (Bos taurus), 475509 (Canis lupus familiaris), 5764 (Homo sapiens), 709496 (Macaca mulatta)
    Gene Symbols & Synonyms PTN,Ptn,OSF,HARP,HBBM,HBBN,HBNF,Osf1,Osf-1,HB-GAM,HBGF-8,Hbnf,HBGF8,NEGF1,OSF-1,HBNF-1
    Target Alternative Names PTN,Pleiotrophin,PTN,Heparin-binding brain mitogen (HBBM), Heparin-binding growth factor 8 (HBGF-8), Heparin-binding growth-associated molecule (HB-GAM), Heparin-binding neurite outgrowth-promoting factor (HBNF), Heparin-binding neurite outgrowth-promoting factor 1 (HBNF-1), Osteoblast-specific factor 1 (OSF-1),HARP,HBBM,HBNF,HBGF8,NEGF1,OSF-1,HB-GAM,HBGF-8,HBNF-1
    Uniprot Accession P21246,P21782,P63089,P63090
    Additional SwissProt Accessions: P63089,P63090,P21782,P21246
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Lung Cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000000593, ENSMUSG00000029838, ENSBTAG00000002317, ENSCAFG00845008663, ENSG00000105894, ENSMMUG00000011836
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.