Human PTN/HARP/HB-GAM ORF/cDNA clone-Lentivirus plasmid (NM_002825)
Cat. No.: pGMLP000869
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human PTN/HARP/HB-GAM Lentiviral expression plasmid for PTN lentivirus packaging, PTN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
PTN/HARP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP000869 |
Gene Name | PTN |
Accession Number | NM_002825 |
Gene ID | 5764 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 507 bp |
Gene Alias | HARP,HB-GAM,HBBM,HBGF-8,HBGF8,HBNF,HBNF-1,NEGF1,OSF-1 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCAGGCTCAACAGTACCAGCAGCAGCGTCGAAAATTTGCAGCTGCCTTCTTGGCATTCATTTTCATACTGGCAGCTGTGGATACTGCTGAAGCAGGGAAGAAAGAGAAACCAGAAAAAAAAGTGAAGAAGTCTGACTGTGGAGAATGGCAGTGGAGTGTGTGTGTGCCCACCAGTGGAGACTGTGGGCTGGGCACACGGGAGGGCACTCGGACTGGAGCTGAGTGCAAGCAAACCATGAAGACCCAGAGATGTAAGATCCCCTGCAACTGGAAGAAGCAATTTGGCGCGGAGTGCAAATACCAGTTCCAGGCCTGGGGAGAATGTGACCTGAACACAGCCCTGAAGACCAGAACTGGAAGTCTGAAGCGAGCCCTGCACAATGCCGAATGCCAGAAGACTGTCACCATCTCCAAGCCCTGTGGCAAACTGACCAAGCCCAAACCTCAAGCAGAATCTAAGAAGAAGAAAAAGGAAGGCAAGAAACAGGAGAAGATGCTGGATTAA |
ORF Protein Sequence | MQAQQYQQQRRKFAAAFLAFIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T49522-Ab | Anti-PTN/ HARP/ HB-GAM monoclonal antibody |
Target Antigen | GM-Tg-g-T49522-Ag | PTN VLP (virus-like particle) |
ORF Viral Vector | pGMLP000869 | Human PTN Lentivirus plasmid |
ORF Viral Vector | pGMAD001512 | Human PTN Adenovirus plasmid |
ORF Viral Vector | vGMLP000869 | Human PTN Lentivirus particle |
ORF Viral Vector | vGMAD001512 | Human PTN Adenovirus particle |
Target information
Target ID | GM-T49522 |
Target Name | PTN |
Gene Group Identifier (Target Gene ID in Homo species) |
5764 |
Gene ID |
100064880 (Equus caballus), 101100041 (Felis catus), 19242 (Mus musculus), 24924 (Rattus norvegicus) 280904 (Bos taurus), 475509 (Canis lupus familiaris), 5764 (Homo sapiens), 709496 (Macaca mulatta) |
Gene Symbols & Synonyms | PTN,Ptn,OSF,HARP,HBBM,HBBN,HBNF,Osf1,Osf-1,HB-GAM,HBGF-8,Hbnf,HBGF8,NEGF1,OSF-1,HBNF-1 |
Target Alternative Names | PTN,Pleiotrophin,PTN,Heparin-binding brain mitogen (HBBM), Heparin-binding growth factor 8 (HBGF-8), Heparin-binding growth-associated molecule (HB-GAM), Heparin-binding neurite outgrowth-promoting factor (HBNF), Heparin-binding neurite outgrowth-promoting factor 1 (HBNF-1), Osteoblast-specific factor 1 (OSF-1),HARP,HBBM,HBNF,HBGF8,NEGF1,OSF-1,HB-GAM,HBGF-8,HBNF-1 |
Uniprot Accession |
P21246,P21782,P63089,P63090
Additional SwissProt Accessions: P63089,P63090,P21782,P21246 |
Uniprot Entry Name | |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | Lung Cancer |
Disease from KEGG | |
Gene Ensembl | ENSECAG00000000593, ENSMUSG00000029838, ENSBTAG00000002317, ENSCAFG00845008663, ENSG00000105894, ENSMMUG00000011836 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.