Human FOLR1/FBP/FOLR ORF/cDNA clone-Lentivirus plasmid (NM_016725)
Cat. No.: pGMLP000860
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human FOLR1/FBP/FOLR Lentiviral expression plasmid for FOLR1 lentivirus packaging, FOLR1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
FOLR1/FBP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000860 |
| Gene Name | FOLR1 |
| Accession Number | NM_016725 |
| Gene ID | 2348 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 774 bp |
| Gene Alias | FBP,FOLR |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCTCAGCGGATGACAACACAGCTGCTGCTCCTTCTAGTGTGGGTGGCTGTAGTAGGGGAGGCTCAGACAAGGATTGCATGGGCCAGGACTGAGCTTCTCAATGTCTGCATGAACGCCAAGCACCACAAGGAAAAGCCAGGCCCCGAGGACAAGTTGCATGAGCAGTGTCGACCCTGGAGGAAGAATGCCTGCTGTTCTACCAACACCAGCCAGGAAGCCCATAAGGATGTTTCCTACCTATATAGATTCAACTGGAACCACTGTGGAGAGATGGCACCTGCCTGCAAACGGCATTTCATCCAGGACACCTGCCTCTACGAGTGCTCCCCCAACTTGGGGCCCTGGATCCAGCAGGTGGATCAGAGCTGGCGCAAAGAGCGGGTACTGAACGTGCCCCTGTGCAAAGAGGACTGTGAGCAATGGTGGGAAGATTGTCGCACCTCCTACACCTGCAAGAGCAACTGGCACAAGGGCTGGAACTGGACTTCAGGGTTTAACAAGTGCGCAGTGGGAGCTGCCTGCCAACCTTTCCATTTCTACTTCCCCACACCCACTGTTCTGTGCAATGAAATCTGGACTCACTCCTACAAGGTCAGCAACTACAGCCGAGGGAGTGGCCGCTGCATCCAGATGTGGTTCGACCCAGCCCAGGGCAACCCCAATGAGGAGGTGGCGAGGTTCTATGCTGCAGCCATGAGTGGGGCTGGGCCCTGGGCAGCCTGGCCTTTCCTGCTTAGCCTGGCCCTAATGCTGCTGTGGCTGCTCAGCTGA |
| ORF Protein Sequence | MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Biosimilar | GMP-Bios-INN-850 | Pre-Made Farletuzumab Ecteribulin Biosimilar, Whole Mab Adc, Anti-Folr1 Antibody: Anti-FBP/FOLR/FRalpha/NCFTD therapeutic antibody Drug Conjugate |
| Biosimilar | GMP-Bios-ab-349 | Pre-Made Mirvetuximab biosimilar, Whole mAb ADC, Anti-FOLR1 Antibody: Anti-FBP/FOLR/FRalpha/NCFTD therapeutic antibody |
| Biosimilar | GMP-Bios-INN-914 | Pre-Made Mirvetuximab Soravtansine Biosimilar, Whole Mab Adc, Anti-Folr1 Antibody: Anti-FBP/FOLR/FRalpha/NCFTD therapeutic antibody Drug Conjugate |
| Biosimilar | GMP-Bios-ab-205 | Pre-Made Farletuzumab biosimilar, Whole mAb, Anti-FOLR1 Antibody: Anti-FBP/FOLR/FRalpha/NCFTD therapeutic antibody |
| Target Antibody | GM-Tg-g-T83386-Ab | Anti-FOLR1/ FBP/ FOLR monoclonal antibody |
| Target Antigen | GM-Tg-g-T83386-Ag | FOLR1 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000860 | Human FOLR1 Lentivirus plasmid |
| ORF Viral Vector | vGMLP000860 | Human FOLR1 Lentivirus particle |
Target information
| Target ID | GM-T83386 |
| Target Name | FOLR1 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
2348 |
| Gene ID |
100066084 (Equus caballus), 101084221 (Felis catus), 14275 (Mus musculus), 171049 (Rattus norvegicus) 2348 (Homo sapiens), 539750 (Bos taurus), 718388 (Macaca mulatta) |
| Gene Symbols & Synonyms | FOLR1,Folr1,FBP1,Folbp1,Folbp-1,Fbp1,FBP,FOLR,NCFTD,FRalpha |
| Target Alternative Names | Adult folate-binding protein (FBP),FBP,FBP1,FOLR,FOLR1,FR-alpha,FRalpha,Fbp1,Folate receptor,Folate receptor 1,Folate receptor alpha,Folbp-1,Folbp1,Folr1,KB cells FBP,NCFTD,Ovarian tumor-associated antigen MOv18,adult |
| Uniprot Accession |
P15328,P35846
Additional SwissProt Accessions: P35846,P15328 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Immuno-oncology Target, INN Index |
| Disease | cancer, Ovary Cancer |
| Disease from KEGG | Antifolate resistance |
| Gene Ensembl | ENSECAG00000020411, ENSMUSG00000001827, ENSG00000110195, ENSBTAG00000021007, ENSMMUG00000010455 |
| Target Classification | Checkpoint-Immuno Oncology |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


