Human FOLR1/FBP/FOLR ORF/cDNA clone-Lentivirus plasmid (NM_016725)

Cat. No.: pGMLP000860
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FOLR1/FBP/FOLR Lentiviral expression plasmid for FOLR1 lentivirus packaging, FOLR1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to FOLR1/FBP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $493.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000860
Gene Name FOLR1
Accession Number NM_016725
Gene ID 2348
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 774 bp
Gene Alias FBP,FOLR
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCAGCGGATGACAACACAGCTGCTGCTCCTTCTAGTGTGGGTGGCTGTAGTAGGGGAGGCTCAGACAAGGATTGCATGGGCCAGGACTGAGCTTCTCAATGTCTGCATGAACGCCAAGCACCACAAGGAAAAGCCAGGCCCCGAGGACAAGTTGCATGAGCAGTGTCGACCCTGGAGGAAGAATGCCTGCTGTTCTACCAACACCAGCCAGGAAGCCCATAAGGATGTTTCCTACCTATATAGATTCAACTGGAACCACTGTGGAGAGATGGCACCTGCCTGCAAACGGCATTTCATCCAGGACACCTGCCTCTACGAGTGCTCCCCCAACTTGGGGCCCTGGATCCAGCAGGTGGATCAGAGCTGGCGCAAAGAGCGGGTACTGAACGTGCCCCTGTGCAAAGAGGACTGTGAGCAATGGTGGGAAGATTGTCGCACCTCCTACACCTGCAAGAGCAACTGGCACAAGGGCTGGAACTGGACTTCAGGGTTTAACAAGTGCGCAGTGGGAGCTGCCTGCCAACCTTTCCATTTCTACTTCCCCACACCCACTGTTCTGTGCAATGAAATCTGGACTCACTCCTACAAGGTCAGCAACTACAGCCGAGGGAGTGGCCGCTGCATCCAGATGTGGTTCGACCCAGCCCAGGGCAACCCCAATGAGGAGGTGGCGAGGTTCTATGCTGCAGCCATGAGTGGGGCTGGGCCCTGGGCAGCCTGGCCTTTCCTGCTTAGCCTGGCCCTAATGCTGCTGTGGCTGCTCAGCTGA
ORF Protein Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-INN-850 Pre-Made Farletuzumab Ecteribulin Biosimilar, Whole Mab Adc, Anti-Folr1 Antibody: Anti-FBP/FOLR/FRalpha/NCFTD therapeutic antibody Drug Conjugate
    Biosimilar GMP-Bios-ab-349 Pre-Made Mirvetuximab biosimilar, Whole mAb ADC, Anti-FOLR1 Antibody: Anti-FBP/FOLR/FRalpha/NCFTD therapeutic antibody
    Biosimilar GMP-Bios-INN-914 Pre-Made Mirvetuximab Soravtansine Biosimilar, Whole Mab Adc, Anti-Folr1 Antibody: Anti-FBP/FOLR/FRalpha/NCFTD therapeutic antibody Drug Conjugate
    Biosimilar GMP-Bios-ab-205 Pre-Made Farletuzumab biosimilar, Whole mAb, Anti-FOLR1 Antibody: Anti-FBP/FOLR/FRalpha/NCFTD therapeutic antibody
    Target Antibody GM-Tg-g-T83386-Ab Anti-FOLR1/ FBP/ FOLR monoclonal antibody
    Target Antigen GM-Tg-g-T83386-Ag FOLR1 VLP (virus-like particle)
    ORF Viral Vector pGMLP000860 Human FOLR1 Lentivirus plasmid
    ORF Viral Vector vGMLP000860 Human FOLR1 Lentivirus particle


    Target information

    Target ID GM-T83386
    Target Name FOLR1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		2348
    Gene ID 100066084 (Equus caballus), 101084221 (Felis catus), 14275 (Mus musculus), 171049 (Rattus norvegicus)
    2348 (Homo sapiens), 539750 (Bos taurus), 718388 (Macaca mulatta)
    Gene Symbols & Synonyms FOLR1,Folr1,FBP1,Folbp1,Folbp-1,Fbp1,FBP,FOLR,NCFTD,FRalpha
    Target Alternative Names Adult folate-binding protein (FBP),FBP,FBP1,FOLR,FOLR1,FR-alpha,FRalpha,Fbp1,Folate receptor,Folate receptor 1,Folate receptor alpha,Folbp-1,Folbp1,Folr1,KB cells FBP,NCFTD,Ovarian tumor-associated antigen MOv18,adult
    Uniprot Accession P15328,P35846
    Additional SwissProt Accessions: P35846,P15328
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target, INN Index
    Disease cancer, Ovary Cancer
    Disease from KEGG Antifolate resistance
    Gene Ensembl ENSECAG00000020411, ENSMUSG00000001827, ENSG00000110195, ENSBTAG00000021007, ENSMMUG00000010455
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.