Human KLRK1/CD314/D12S2489E ORF/cDNA clone-Lentivirus plasmid (NM_007360)

Cat. No.: pGMLP000859
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human KLRK1/CD314/D12S2489E Lentiviral expression plasmid for KLRK1 lentivirus packaging, KLRK1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CD314/NKG2D/KLRK1/KLRK1/CD314 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $462.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000859
Gene Name KLRK1
Accession Number NM_007360
Gene ID 22914
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 651 bp
Gene Alias CD314,D12S2489E,KLR,NKG2-D,NKG2D
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGTGGATTCGTGGTCGGAGGTCTCGACACAGCTGGGAGATGAGTGAATTTCATAATTATAACTTGGATCTGAAGAAGAGTGATTTTTCAACACGATGGCAAAAGCAAAGATGTCCAGTAGTCAAAAGCAAATGTAGAGAAAATGCATCTCCATTTTTTTTCTGCTGCTTCATCGCTGTAGCCATGGGAATCCGTTTCATTATTATGGTAACAATATGGAGTGCTGTATTCCTAAACTCATTATTCAACCAAGAAGTTCAAATTCCCTTGACCGAAAGTTACTGTGGCCCATGTCCTAAAAACTGGATATGTTACAAAAATAACTGCTACCAATTTTTTGATGAGAGTAAAAACTGGTATGAGAGCCAGGCTTCTTGTATGTCTCAAAATGCCAGCCTTCTGAAAGTATACAGCAAAGAGGACCAGGATTTACTTAAACTGGTGAAGTCATATCATTGGATGGGACTAGTACACATTCCAACAAATGGATCTTGGCAGTGGGAAGATGGCTCCATTCTCTCACCCAACCTACTAACAATAATTGAAATGCAGAAGGGAGACTGTGCACTCTATGCCTCGAGCTTTAAAGGCTATATAGAAAACTGTTCAACTCCAAATACGTACATCTGCATGCAAAGGACTGTGTAA
ORF Protein Sequence MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVTIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-566 Pre-Made Tesnatilimab biosimilar, Whole mAb, Anti-KLRK1 Antibody: Anti-CD314/D12S2489E/KLR/NKG2-D/NKG2D therapeutic antibody
    Target Antibody GM-Tg-g-T35289-Ab Anti-NKG2D/ KLRK1/ CD314 monoclonal antibody
    Target Antigen GM-Tg-g-T35289-Ag KLRK1 VLP (virus-like particle)
    ORF Viral Vector pGMLP000859 Human KLRK1 Lentivirus plasmid
    ORF Viral Vector vGMLP000859 Human KLRK1 Lentivirus particle


    Target information

    Target ID GM-T35289
    Target Name CD314/NKG2D/KLRK1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		22914
    Gene ID 100053963 (Equus caballus), 22914 (Homo sapiens), 24934 (Rattus norvegicus), 27007 (Mus musculus)
    404058 (Bos taurus), 611355 (Canis lupus familiaris)
    Gene Symbols & Synonyms KLRK1,Klrk1,KLR,CD314,NKG2D,NKG2-D,D12S2489E,Nkrp2,Nkg2d,D6H12S2489E,KLRC
    Target Alternative Names CD314, NKG2D, KLRK1,NKG2-D type II integral membrane protein,Killer cell lectin-like receptor subfamily K member 1, NK cell receptor D, NKG2-D-activating NK receptor,KLR,CD314,NKG2D,NKG2-D,D12S2489E
    Uniprot Accession O54709,O70215,P26718
    Additional SwissProt Accessions: P26718,O70215,O54709
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target, INN Index
    Disease cancer
    Disease from KEGG Natural killer cell mediated cytotoxicity, Malaria
    Gene Ensembl ENSECAG00000017267, ENSG00000213809, ENSMUSG00000030149, ENSBTAG00000004917, ENSCAFG00845026278
    Target Classification Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.