Human KCNE1/ISK/JLNS ORF/cDNA clone-Lentivirus plasmid (NM_000219)

Cat. No.: pGMLP000844
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human KCNE1/ISK/JLNS Lentiviral expression plasmid for KCNE1 lentivirus packaging, KCNE1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to KCNE1/ISK products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000844
Gene Name KCNE1
Accession Number NM_000219
Gene ID 3753
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 390 bp
Gene Alias ISK,JLNS,JLNS2,LQT2/5,LQT5,MinK
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATCCTGTCTAACACCACAGCGGTGACGCCCTTTCTGACCAAGCTGTGGCAGGAGACAGTTCAGCAGGGTGGCAACATGTCGGGCCTGGCCCGCAGGTCCCCCCGCAGCAGTGACGGCAAGCTGGAGGCCCTCTACGTCCTCATGGTACTGGGATTCTTCGGCTTCTTCACCCTGGGCATCATGCTGAGCTACATCCGCTCCAAGAAGCTGGAGCACTCGAACGACCCATTCAACGTCTACATCGAGTCCGATGCCTGGCAAGAGAAGGACAAGGCCTATGTCCAGGCCCGGGTCCTGGAGAGCTACAGGTCGTGCTATGTCGTTGAAAACCATCTGGCCATAGAACAACCCAACACACACCTTCCTGAGACGAAGCCTTCCCCATGA
ORF Protein Sequence MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0655-Ab Anti-KCNE1/ ISK/ JLNS monoclonal antibody
    Target Antigen GM-Tg-g-MP0655-Ag KCNE1 VLP (virus-like particle)
    ORF Viral Vector pGMLP000844 Human KCNE1 Lentivirus plasmid
    ORF Viral Vector vGMLP000844 Human KCNE1 Lentivirus particle


    Target information

    Target ID GM-MP0655
    Target Name KCNE1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    3753
    Gene ID 100062537 (Equus caballus), 16509 (Mus musculus), 25471 (Rattus norvegicus), 3753 (Homo sapiens)
    487743 (Canis lupus familiaris), 493681 (Felis catus), 528014 (Bos taurus), 697229 (Macaca mulatta)
    Gene Symbols & Synonyms KCNE1,Kcne1,Isk,MinK,nmf190,ISK,JLNS,LQT5,JLNS2,LQT2/5,minK
    Target Alternative Names Delayed rectifier potassium channel subunit IsK,IKs producing slow voltage-gated potassium channel subunit beta Mink,ISK,Isk,JLNS,JLNS2,KCNE1,Kcne1,LQT2/5,LQT5,MinK,Minimal potassium channel (MinK),Potassium voltage-gated channel subfamily E member 1,minK,nmf190
    Uniprot Accession P15382,P15383,P23299,Q9XSP1
    Additional SwissProt Accessions: P23299,P15383,P15382,Q9XSP1
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG Adrenergic signaling in cardiomyocytes
    Gene Ensembl ENSECAG00000004065, ENSMUSG00000039639, ENSG00000180509, ENSBTAG00000001150
    Target Classification Ion Channel


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.