Human BCL2L2/BCL-W/BCLW ORF/cDNA clone-Lentivirus plasmid (BC113522)

Cat. No.: pGMLP000803
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human BCL2L2/BCL-W/BCLW Lentiviral expression plasmid for BCL2L2 lentivirus packaging, BCL2L2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to BCL2L2/BCL-W/BCL2L2/BCL-W products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $445.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000803
Gene Name BCL2L2
Accession Number BC113522
Gene ID 599
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 582 bp
Gene Alias BCL-W,BCLW,KIAA0271
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGACCCCAGCCTCGGCCCCAGACACACGGGCTCTGGTGGCAGACTTTGTAGGTTATAAGCTGAGGCAGAAGGGTTATGTCTGTGGAGCTGGCCCCGGGGAGGGCCCAGCAGCTGACCCACTGCACCAAGCCATGCGGGCAGCTGGAGATGAGTTCGAGACCCGCTTCCGGCGCACCTTCTCTGATCTGGCGGCTCAGCTGCATGTGACCCCAGGCTCAGCCCAACAACGCTTCACCCAGGTCTCCGATGAACTTTTTCAAGGGGGCCCCAACTGGGGCCGCCTTGTAGCCTTCTTTGTCTTTGGGGCTGCACTGTGTGCTGAGAGTGTCAACAAGGAGATGGAACCACTGGTGGGACAAGTGCAGGAGTGGATGGTGGCCTACCTGGAGACGCGGCTGGCTGACTGGATCCACAGCAGTGGGGGCTGGGCGGAGTTCACAGCTCTATACGGGGACGGGGCCCTGGAGGAGGCGCGGCGTCTGCGGGAGGGGAACTGGGCATCAGTGAGGACAGTGCTGACGGGGGCCGTGGCACTGGGGGCCCTGGTAACTGTAGGGGCCTTTTTTGCTAGCAAGTGA
ORF Protein Sequence MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0051-Ab Anti-BCL-W monoclonal antibody
    Target Antigen GM-Tg-g-IP0051-Ag BCL-W/BCL2L2 protein
    ORF Viral Vector pGMLP000803 Human BCL2L2 Lentivirus plasmid
    ORF Viral Vector vGMLP000803 Human BCL2L2 Lentivirus particle


    Target information

    Target ID GM-IP0051
    Target Name BCL2L2/BCL-W
    Gene Group Identifier
    （Target Gene ID in Homo species)         		599
    Gene ID 100055644 (Equus caballus), 12050 (Mus musculus), 599 (Homo sapiens), 60434 (Rattus norvegicus)
    767601 (Bos taurus)
    Gene Symbols & Synonyms BCL2L2,Bcl2l2,c98,bclw,Bcl-w,Gtrgal2,Gtrosa41,BCLW,BCL-W,PPP1R51,BCL2-L-2,Bclw,BCL-WS,BCL-WEL,RELA
    Target Alternative Names Apoptosis regulator Bcl-W,BCL-W,BCL-WEL,BCL-WS,BCL2-L-2,BCL2L2,BCLW,Bcl-2-like protein 2,Bcl-w,Bcl2-L-2,Bcl2l2,Bclw,Gtrgal2,Gtrosa41,PPP1R51,RELA,bclw,c98
    Uniprot Accession P70345,Q1RMX3,Q92843
    Additional SwissProt Accessions: P70345,Q92843,Q1RMX3
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer, Breast Cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000011652, ENSMUSG00000089682, ENSG00000129473, ENSBTAG00000019692
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.