Human GNRH1/GNRH/GRH ORF/cDNA clone-Lentivirus plasmid (NM_000825)

Cat. No.: pGMLP000781
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GNRH1/GNRH/GRH Lentiviral expression plasmid for GNRH1 lentivirus packaging, GNRH1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to GNRH1/GNRH products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000781
Gene Name GNRH1
Accession Number NM_000825
Gene ID 2796
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 291 bp
Gene Alias GNRH,GRH,LHRH,LNRH
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGCCTTAGAATGAAGCCAATTCAAAAACTCCTAGCTGGCCTTATTCTACTGACTTGGTGCGTGGAAGGCTGCTCCAGCCAGCACTGGTCCTATGGACTGCGCCCTGGAGGAAAGAGAGATGCCGAAAATTTGATTGATTCTTTCCAAGAGATAGTCAAAGAGGTTGGTCAACTGGCAGAAACCCAACGCTTCGAATGCACCACGCACCAGCCACGTTCTCCCCTCCGAGACCTGAAAGGAGCTCTGGAAAGTCTGATTGAAGAGGAAACTGGGCAGAAGAAGATTTAA
ORF Protein Sequence MCLRMKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T18950-Ab Anti-GON1/ GNRH1/ GNRH functional antibody
    Target Antigen GM-Tg-g-T18950-Ag GNRH1 protein
    ORF Viral Vector pGMLP000781 Human GNRH1 Lentivirus plasmid
    ORF Viral Vector vGMLP000781 Human GNRH1 Lentivirus particle


    Target information

    Target ID GM-T18950
    Target Name GNRH1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2796
    Gene ID 100630270 (Equus caballus), 101080783 (Felis catus), 14714 (Mus musculus), 25194 (Rattus norvegicus)
    2796 (Homo sapiens), 608671 (Canis lupus familiaris), 613033 (Macaca mulatta), 768325 (Bos taurus)
    Gene Symbols & Synonyms GNRH1,Gnrh1,hpg,Gnrh,LHRH,Lnrh,Gnrh2,Lhrh1,Lhrh,SH-4,Gnrha,Rgnrhg1,GRH,GNRH,LNRH
    Target Alternative Names GNRH,GNRH1,GRH,Gnrh,Gnrh1,Gnrh2,Gnrha,LHRH,LNRH,Lhrh,Lhrh1,Lnrh,Progonadoliberin I,Progonadoliberin-1,Rgnrhg1,SH-4,hpg
    Uniprot Accession P01148,P07490,P55248,P13562,P55247
    Additional SwissProt Accessions: P13562,P07490,P55248,P01148,P55247
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease
    Disease from KEGG Neuroactive ligand-receptor interaction, GnRH signaling pathway, GnRH secretion
    Gene Ensembl ENSMUSG00000015812, ENSG00000147437, ENSCAFG00845014221, ENSMMUG00000029018, ENSBTAG00000000164
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.