Human LY6E/RIG-E/RIGE ORF/cDNA clone-Lentivirus plasmid (NM_002346)

Cat. No.: pGMLP000777
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human LY6E/RIG-E/RIGE Lentiviral expression plasmid for LY6E lentivirus packaging, LY6E lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to LY6E/RIG-E products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000777
Gene Name LY6E
Accession Number NM_002346
Gene ID 4061
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 396 bp
Gene Alias RIG-E,RIGE,SCA-2,SCA2,TSA-1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGATCTTCTTGCCAGTGCTGCTGGCTGCCCTTCTGGGTGTGGAGCGAGCCAGCTCGCTGATGTGCTTCTCCTGCTTGAACCAGAAGAGCAATCTGTACTGCCTGAAGCCGACCATCTGCTCCGACCAGGACAACTACTGCGTGACTGTGTCTGCTAGTGCCGGCATTGGGAATCTCGTGACATTTGGCCACAGCCTGAGCAAGACCTGTTCCCCGGCCTGCCCCATCCCAGAAGGCGTCAATGTTGGTGTGGCTTCCATGGGCATCAGCTGCTGCCAGAGCTTTCTGTGCAATTTCAGTGCGGCCGATGGCGGGCTGCGGGCAAGCGTCACCCTGCTGGGTGCCGGGCTGCTGCTGAGCCTGCTGCCGGCCCTGCTGCGGTTTGGCCCCTGA
ORF Protein Sequence MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0776-Ab Anti-LY6E/ RIG-E/ RIGE monoclonal antibody
    Target Antigen GM-Tg-g-MP0776-Ag LY6E VLP (virus-like particle)
    ORF Viral Vector pGMLP000777 Human LY6E Lentivirus plasmid
    ORF Viral Vector vGMLP000777 Human LY6E Lentivirus particle


    Target information

    Target ID GM-MP0776
    Target Name LY6E
    Gene Group Identifier
    （Target Gene ID in Homo species)         		4061
    Gene ID 100066193 (Equus caballus), 100683006 (Canis lupus familiaris), 101098195 (Felis catus), 114680363 (Macaca mulatta)
    17069 (Mus musculus), 362934 (Rattus norvegicus), 4061 (Homo sapiens), 510977 (Bos taurus)
    Gene Symbols & Synonyms LY6E,Ly6e,Ly67,Tsa1,RIG-E,Sca-2,TSA-1,RIGE,SCA2,SCA-2
    Target Alternative Names LY6E,Lymphocyte antigen 6E,Ly-6E,Retinoic acid-induced gene E protein (RIG-E), Stem cell antigen 2 (SCA-2), Thymic shared antigen 1 (TSA-1),RIGE,SCA2,RIG-E,SCA-2,TSA-1
    Uniprot Accession Q16553,Q64253
    Additional SwissProt Accessions: Q64253,Q16553
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSMUSG00000022587, ENSG00000160932
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.