Human LY6E/RIG-E/RIGE ORF/cDNA clone-Lentivirus plasmid (NM_002346)
Cat. No.: pGMLP000777
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human LY6E/RIG-E/RIGE Lentiviral expression plasmid for LY6E lentivirus packaging, LY6E lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
LY6E/RIG-E products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP000777 |
Gene Name | LY6E |
Accession Number | NM_002346 |
Gene ID | 4061 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 396 bp |
Gene Alias | RIG-E,RIGE,SCA-2,SCA2,TSA-1 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAAGATCTTCTTGCCAGTGCTGCTGGCTGCCCTTCTGGGTGTGGAGCGAGCCAGCTCGCTGATGTGCTTCTCCTGCTTGAACCAGAAGAGCAATCTGTACTGCCTGAAGCCGACCATCTGCTCCGACCAGGACAACTACTGCGTGACTGTGTCTGCTAGTGCCGGCATTGGGAATCTCGTGACATTTGGCCACAGCCTGAGCAAGACCTGTTCCCCGGCCTGCCCCATCCCAGAAGGCGTCAATGTTGGTGTGGCTTCCATGGGCATCAGCTGCTGCCAGAGCTTTCTGTGCAATTTCAGTGCGGCCGATGGCGGGCTGCGGGCAAGCGTCACCCTGCTGGGTGCCGGGCTGCTGCTGAGCCTGCTGCCGGCCCTGCTGCGGTTTGGCCCCTGA |
ORF Protein Sequence | MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP0776-Ab | Anti-LY6E/ RIG-E/ RIGE monoclonal antibody |
Target Antigen | GM-Tg-g-MP0776-Ag | LY6E VLP (virus-like particle) |
ORF Viral Vector | pGMLP000777 | Human LY6E Lentivirus plasmid |
ORF Viral Vector | vGMLP000777 | Human LY6E Lentivirus particle |
Target information
Target ID | GM-MP0776 |
Target Name | LY6E |
Gene Group Identifier (Target Gene ID in Homo species) |
4061 |
Gene ID |
100066193 (Equus caballus), 100683006 (Canis lupus familiaris), 101098195 (Felis catus), 114680363 (Macaca mulatta) 17069 (Mus musculus), 362934 (Rattus norvegicus), 4061 (Homo sapiens), 510977 (Bos taurus) |
Gene Symbols & Synonyms | LY6E,Ly6e,Ly67,Tsa1,RIG-E,Sca-2,TSA-1,RIGE,SCA2,SCA-2 |
Target Alternative Names | LY6E,Lymphocyte antigen 6E,Ly-6E,Retinoic acid-induced gene E protein (RIG-E), Stem cell antigen 2 (SCA-2), Thymic shared antigen 1 (TSA-1),RIGE,SCA2,RIG-E,SCA-2,TSA-1 |
Uniprot Accession |
Q16553,Q64253
Additional SwissProt Accessions: Q64253,Q16553 |
Uniprot Entry Name | |
Protein Sub-location | Transmembrane Protein |
Category | |
Disease | |
Disease from KEGG | |
Gene Ensembl | ENSMUSG00000022587, ENSG00000160932 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.