Human STEAP1/PRSS24/STEAP ORF/cDNA clone-Lentivirus plasmid (NM_012449)

Cat. No.: pGMLP000755
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human STEAP1/PRSS24/STEAP Lentiviral expression plasmid for STEAP1 lentivirus packaging, STEAP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to STEAP1/PRSS24 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $585.6
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000755
Gene Name STEAP1
Accession Number NM_012449
Gene ID 26872
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1020 bp
Gene Alias PRSS24,STEAP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAAAGCAGAAAAGACATCACAAACCAAGAAGAACTTTGGAAAATGAAGCCTAGGAGAAATTTAGAAGAAGACGATTATTTGCATAAGGACACGGGAGAGACCAGCATGCTAAAAAGACCTGTGCTTTTGCATTTGCACCAAACAGCCCATGCTGATGAATTTGACTGCCCTTCAGAACTTCAGCACACACAGGAACTCTTTCCACAGTGGCACTTGCCAATTAAAATAGCTGCTATTATAGCATCTCTGACTTTTCTTTACACTCTTCTGAGGGAAGTAATTCACCCTTTAGCAACTTCCCATCAACAATATTTTTATAAAATTCCAATCCTGGTCATCAACAAAGTCTTGCCAATGGTTTCCATCACTCTCTTGGCATTGGTTTACCTGCCAGGTGTGATAGCAGCAATTGTCCAACTTCATAATGGAACCAAGTATAAGAAGTTTCCACATTGGTTGGATAAGTGGATGTTAACAAGAAAGCAGTTTGGGCTTCTCAGTTTCTTTTTTGCTGTACTGCATGCAATTTATAGTCTGTCTTACCCAATGAGGCGATCCTACAGATACAAGTTGCTAAACTGGGCATATCAACAGGTCCAACAAAATAAAGAAGATGCCTGGATTGAGCATGATGTTTGGAGAATGGAGATTTATGTGTCTCTGGGAATTGTGGGATTGGCAATACTGGCTCTGTTGGCTGTGACATCTATTCCATCTGTGAGTGACTCTTTGACATGGAGAGAATTTCACTATATTCAGAGCAAGCTAGGAATTGTTTCCCTTCTACTGGGCACAATACACGCATTGATTTTTGCCTGGAATAAGTGGATAGATATAAAACAATTTGTATGGTATACACCTCCAACTTTTATGATAGCTGTTTTCCTTCCAATTGTTGTCCTGATATTTAAAAGCATACTATTCCTGCCATGCTTGAGGAAGAAGATACTGAAGATTAGACATGGTTGGGAAGACGTCACCAAAATTAACAAAACTGAGATATGTTCCCAGTTGTAG
ORF Protein Sequence MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-INN-1044 Pre-Made Vandortuzumab Vedotin Biosimilar, Whole Mab Adc, Anti-Steap1 Antibody: Anti-PRSS24/STEAP therapeutic antibody Drug Conjugate
    Biosimilar GMP-Bios-ab-610 Pre-Made Vandortuzumab biosimilar, Whole mAb ADC, Anti-STEAP1 Antibody: Anti-PRSS24/STEAP therapeutic antibody
    Target Antibody GM-Tg-g-T91286-Ab Anti-STEA1/ STEAP1/ PRSS24 monoclonal antibody
    Target Antigen GM-Tg-g-T91286-Ag STEAP1 VLP (virus-like particle)
    ORF Viral Vector pGMLP000755 Human STEAP1 Lentivirus plasmid
    ORF Viral Vector vGMLP000755 Human STEAP1 Lentivirus particle


    Target information

    Target ID GM-T91286
    Target Name STEAP1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    26872
    Gene ID 100060223 (Equus caballus), 101080700 (Felis catus), 26872 (Homo sapiens), 297738 (Rattus norvegicus)
    475222 (Canis lupus familiaris), 515156 (Bos taurus), 70358 (Mus musculus), 704448 (Macaca mulatta)
    Gene Symbols & Synonyms STEAP1,Steap1,STEAP,PRSS24,Steap,Prss24,2410007B19Rik
    Target Alternative Names 2410007B19Rik,PRSS24,Prss24,STEAP,STEAP1,STEAP1 protein,Six-transmembrane epithelial antigen of prostate 1,Steap,Steap1
    Uniprot Accession Q9CWR7,Q9UHE8
    Additional SwissProt Accessions: Q9UHE8,Q9CWR7
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, INN Index
    Disease
    Disease from KEGG Mineral absorption
    Gene Ensembl ENSECAG00000023308, ENSG00000164647, ENSCAFG00845011089, ENSBTAG00000015749, ENSMUSG00000015652, ENSMMUG00000011602
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.