Human CD79B/AGM6/B29 ORF/cDNA clone-Lentivirus plasmid (NM_000626.3)

Cat. No.: pGMLP000751
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CD79B/AGM6/B29 Lentiviral expression plasmid for CD79B lentivirus packaging, CD79B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CD79B/CD79b/CD79B/AGM6 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $472.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000751
Gene Name CD79B
Accession Number NM_000626.3
Gene ID 974
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 690 bp
Gene Alias AGM6,B29,IGB
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCAGGCTGGCGTTGTCTCCTGTGCCCAGCCACTGGATGGTGGCGTTGCTGCTGCTGCTCTCAGCTGAGCCAGTACCAGCAGCCAGATCGGAGGACCGGTACCGGAATCCCAAAGGTAGTGCTTGTTCGCGGATCTGGCAGAGCCCACGTTTCATAGCCAGGAAACGGGGCTTCACGGTGAAAATGCACTGCTACATGAACAGCGCCTCCGGCAATGTGAGCTGGCTCTGGAAGCAGGAGATGGACGAGAATCCCCAGCAGCTGAAGCTGGAAAAGGGCCGCATGGAAGAGTCCCAGAACGAATCTCTCGCCACCCTCACCATCCAAGGCATCCGGTTTGAGGACAATGGCATCTACTTCTGTCAGCAGAAGTGCAACAACACCTCGGAGGTCTACCAGGGCTGCGGCACAGAGCTGCGAGTCATGGGATTCAGCACCTTGGCACAGCTGAAGCAGAGGAACACGCTGAAGGATGGTATCATCATGATCCAGACGCTGCTGATCATCCTCTTCATCATCGTGCCTATCTTCCTGCTGCTGGACAAGGATGACAGCAAGGCTGGCATGGAGGAAGATCACACCTACGAGGGCCTGGACATTGACCAGACAGCCACCTATGAGGACATAGTGACGCTGCGGACAGGGGAAGTGAAGTGGTCTGTAGGTGAGCACCCAGGCCAGGAGTGA
ORF Protein Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-INN-962 Pre-Made Polatuzumab Vedotin Biosimilar, Whole Mab Adc, Anti-Cd79B Antibody: Anti-AGM6/B29/IGB therapeutic antibody Drug Conjugate
    Biosimilar GMP-Bios-INN-862 Pre-Made Iladatuzumab Vedotin Biosimilar, Whole Mab Adc, Anti-Cd79B Antibody: Anti-AGM6/B29/IGB therapeutic antibody Drug Conjugate
    Biosimilar GMP-Bios-ab-264 Pre-Made Iladatuzumab biosimilar, Whole mAb ADC, Anti-CD79B Antibody: Anti-AGM6/B29/IGB therapeutic antibody
    Biosimilar GMP-Bios-ab-449 Pre-Made Polatuzumab biosimilar, Whole mAb ADC, Anti-CD79B Antibody: Anti-AGM6/B29/IGB therapeutic antibody
    Target Antibody GM-Tg-g-T08306-Ab Anti-CD79B/ AGM6/ B29 monoclonal antibody
    Target Antigen GM-Tg-g-T08306-Ag CD79B VLP (virus-like particle)
    ORF Viral Vector pGMLP000751 Human CD79B Lentivirus plasmid
    ORF Viral Vector vGMLP000751 Human CD79B Lentivirus particle


    Target information

    Target ID GM-T08306
    Target Name CD79B/CD79b
    Gene Group Identifier
    （Target Gene ID in Homo species)         		974
    Gene ID 100064460 (Equus caballus), 101098098 (Felis catus), 15985 (Mus musculus), 171055 (Rattus norvegicus)
    509801 (Bos taurus), 609449 (Canis lupus familiaris), 718218 (Macaca mulatta), 974 (Homo sapiens)
    Gene Symbols & Synonyms CD79B,Cd79b,B29,Igb,Igbeta,Ig-beta,IGB,AGM6
    Target Alternative Names AGM6,B-cell antigen receptor complex-associated protein beta chain,B-cell-specific glycoprotein B29,B29,CD79B,CD79b,Cd79b,IGB,Ig-beta,Igb,Igbeta,Immunoglobulin-associated B29 protein
    Uniprot Accession P15530,P40259
    Additional SwissProt Accessions: P15530,P40259
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, INN Index
    Disease cancer
    Disease from KEGG B cell receptor signaling pathway
    Gene Ensembl ENSECAG00000037399, ENSMUSG00000040592, ENSBTAG00000044204, ENSCAFG00845021479, ENSMMUG00000041327, ENSG00000007312
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.