Human TNFRSF12A/CD266/FN14 ORF/cDNA clone-Lentivirus plasmid (NM_016639)
Cat. No.: pGMLP000633
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human TNFRSF12A/CD266/FN14 Lentiviral expression plasmid for TNFRSF12A lentivirus packaging, TNFRSF12A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
TWEAKR/CD266/TNFRSF12A/TNFRSF12A/CD266 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000633 |
| Gene Name | TNFRSF12A |
| Accession Number | NM_016639 |
| Gene ID | 51330 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 390 bp |
| Gene Alias | CD266,FN14,TWEAKR |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCTCGGGGCTCGCTGCGCCGGTTGCTGCGGCTCCTCGTGCTGGGGCTCTGGCTGGCGTTGCTGCGCTCCGTGGCCGGGGAGCAAGCGCCAGGCACCGCCCCCTGCTCCCGCGGCAGCTCCTGGAGCGCGGACCTGGACAAGTGCATGGACTGCGCGTCTTGCAGGGCGCGACCGCACAGCGACTTCTGCCTGGGCTGCGCTGCAGCACCTCCTGCCCCCTTCCGGCTGCTTTGGCCCATCCTTGGGGGCGCTCTGAGCCTGACCTTCGTGCTGGGGCTGCTTTCTGGCTTTTTGGTCTGGAGACGATGCCGCAGGAGAGAGAAGTTCACCACCCCCATAGAGGAGACCGGCGGAGAGGGCTGCCCAGCTGTGGCGCTGATCCAGTGA |
| ORF Protein Sequence | MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Biosimilar | GMP-Bios-ab-180 | Pre-Made Enavatuzumab biosimilar, Whole mAb, Anti-TNFRSF12A Antibody: Anti-CD2664/TWEAKR therapeutic antibody |
| Target Antibody | GM-Tg-g-T28717-Ab | Anti-TNR12/ TNFRSF12A/ CD266 monoclonal antibody |
| Target Antigen | GM-Tg-g-T28717-Ag | TNFRSF12A VLP (virus-like particle) |
| Cytokine | cks-Tg-g-GM-T28717 | Tumor necrosis factor receptor superfamily, member 12A (TNFRSF12A) protein & antibody |
| ORF Viral Vector | pGMLP000633 | Human TNFRSF12A Lentivirus plasmid |
| ORF Viral Vector | pGMLV001138 | Human TNFRSF12A Lentivirus plasmid |
| ORF Viral Vector | pGMLV002476 | Human TNFRSF12A Lentivirus plasmid |
| ORF Viral Vector | pGMAD001671 | Human TNFRSF12A Adenovirus plasmid |
| ORF Viral Vector | vGMLP000633 | Human TNFRSF12A Lentivirus particle |
| ORF Viral Vector | vGMLV001138 | Human TNFRSF12A Lentivirus particle |
| ORF Viral Vector | vGMLV002476 | Human TNFRSF12A Lentivirus particle |
| ORF Viral Vector | vGMAD001671 | Human TNFRSF12A Adenovirus particle |
Target information
| Target ID | GM-T28717 |
| Target Name | TWEAKR/CD266/TNFRSF12A |
|
Gene Group Identifier (Target Gene ID in Homo species) |
51330 |
| Gene ID |
100146755 (Equus caballus), 101098186 (Felis catus), 27279 (Mus musculus), 302965 (Rattus norvegicus) 51330 (Homo sapiens), 610734 (Canis lupus familiaris), 617439 (Bos taurus), 699970 (Macaca mulatta) |
| Gene Symbols & Synonyms | TNFRSF12A,Tnfrsf12a,Fn14,HPIP,TweakR,TWEAK-R,FN14,CD266,TWEAKR |
| Target Alternative Names | CD266,FN14,Fibroblast growth factor-inducible immediate-early response protein 14 (FGF-inducible 14),Fn14,HPIP,TNFRSF12A,TWEAK-R,TWEAKR,Tnfrsf12a,Tumor necrosis factor receptor superfamily member 12A,Tweak-receptor (TweakR),TweakR |
| Uniprot Accession |
Q9CR75,Q9NP84
Additional SwissProt Accessions: Q9CR75,Q9NP84 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Immuno-oncology Target, INN Index, Cytokine Target |
| Disease | |
| Disease from KEGG | Cytokine-cytokine receptor interaction |
| Gene Ensembl | ENSMUSG00000023905, ENSG00000006327, ENSBTAG00000012082 |
| Target Classification | Checkpoint-Immuno Oncology |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


