Human FASLG/ALPS1B/APT1LG1 ORF/cDNA clone-Lentivirus plasmid (NM_000639)
Cat. No.: pGMLP000545
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human FASLG/ALPS1B/APT1LG1 Lentiviral expression plasmid for FASLG lentivirus packaging, FASLG lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
FASLG/CD178/FASLG/ALPS1B products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP000545 |
Gene Name | FASLG |
Accession Number | NM_000639 |
Gene ID | 356 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 846 bp |
Gene Alias | ALPS1B,APT1LG1,APTL,CD178,CD95-L,CD95L,FASL,TNFSF6,TNLG1A |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCAGCAGCCCTTCAATTACCCATATCCCCAGATCTACTGGGTGGACAGCAGTGCCAGCTCTCCCTGGGCCCCTCCAGGCACAGTTCTTCCCTGTCCAACCTCTGTGCCCAGAAGGCCTGGTCAAAGGAGGCCACCACCACCACCGCCACCGCCACCACTACCACCTCCGCCGCCGCCGCCACCACTGCCTCCACTACCGCTGCCACCCCTGAAGAAGAGAGGGAACCACAGCACAGGCCTGTGTCTCCTTGTGATGTTTTTCATGGTTCTGGTTGCCTTGGTAGGATTGGGCCTGGGGATGTTTCAGCTCTTCCACCTACAGAAGGAGCTGGCAGAACTCCGAGAGTCTACCAGCCAGATGCACACAGCATCATCTTTGGAGAAGCAAATAGGCCACCCCAGTCCACCCCCTGAAAAAAAGGAGCTGAGGAAAGTGGCCCATTTAACAGGCAAGTCCAACTCAAGGTCCATGCCTCTGGAATGGGAAGACACCTATGGAATTGTCCTGCTTTCTGGAGTGAAGTATAAGAAGGGTGGCCTTGTGATCAATGAAACTGGGCTGTACTTTGTATATTCCAAAGTATACTTCCGGGGTCAATCTTGCAACAACCTGCCCCTGAGCCACAAGGTCTACATGAGGAACTCTAAGTATCCCCAGGATCTGGTGATGATGGAGGGGAAGATGATGAGCTACTGCACTACTGGGCAGATGTGGGCCCGCAGCAGCTACCTGGGGGCAGTGTTCAATCTTACCAGTGCTGATCATTTATATGTCAACGTATCTGAGCTCTCTCTGGTCAATTTTGAGGAATCTCAGACGTTTTTCGGCTTATATAAGCTCTAA |
ORF Protein Sequence | MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Biosimilar | GMP-Bios-INN-741 | Pre-Made Asunercept Biosimilar, Fusion Protein targeting FASLG/CD178 fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting ALPS1B/APT1LG1/APTL/CD95-L/CD95L/FASL/TNFSF6/TNLG1A |
Target Antibody | GM-Tg-g-T64245-Ab | Anti-TNFL6/ CD178/ FASLG monoclonal antibody |
Target Antigen | GM-Tg-g-T64245-Ag | CD178/FASLG VLP (virus-like particle) |
Cytokine | cks-Tg-g-GM-T64245 | Fas ligand (TNF superfamily, member 6) (FASL) protein & antibody |
ORF Viral Vector | pGMLP000545 | Human FASLG Lentivirus plasmid |
ORF Viral Vector | pGMAP000429 | Human FASLG Adenovirus plasmid |
ORF Viral Vector | vGMLP000545 | Human FASLG Lentivirus particle |
ORF Viral Vector | vGMAP000429 | Human FASLG Adenovirus particle |
Target information
Target ID | GM-T64245 |
Target Name | FASLG/CD178 |
Gene Group Identifier (Target Gene ID in Homo species) |
356 |
Gene ID |
100052326 (Equus caballus), 14103 (Mus musculus), 25385 (Rattus norvegicus), 356 (Homo sapiens) 407111 (Bos taurus), 442968 (Canis lupus familiaris), 493945 (Felis catus), 574159 (Macaca mulatta) |
Gene Symbols & Synonyms | FASLG,Fasl,Faslg,fasL,TNLG1A,gld,CD178,CD95L,Fas-L,CD95-L,Tnfsf6,Tnlg1a,APT1LG1,Apt1Lg1,APTL,FASL,ALPS1B,TNFSF6 |
Target Alternative Names | FASLG, CD178,Tumor necrosis factor ligand superfamily member 6,Apoptosis antigen ligand (APTL), CD95 ligand (CD95-L), Fas antigen ligand (Fas ligand, FasL),APTL,FASL,CD178,CD95L,ALPS1B,CD95-L,TNFSF6,TNLG1A,APT1LG1 |
Uniprot Accession |
P36940,P41047,P48023,P63307,Q861W5
Additional SwissProt Accessions: P41047,P36940,P48023,Q861W5,P63307 |
Uniprot Entry Name | |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target, INN Index, Cytokine Target |
Disease | cancer, Malignant neoplasm of bladder |
Disease from KEGG | MAPK signaling pathway, Ras signaling pathway, Cytokine-cytokine receptor interaction, FoxO signaling pathway, PI3K-Akt signaling pathway, Apoptosis, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, Alcoholic liver disease, Type I diabetes mellitus, Pathogenic Escherichia coli infection, Chagas disease, African trypanosomiasis, Hepatitis C, Hepatitis B, Measles, Human cytomegalovirus infection, Influenza A, Human papillomavirus infection, Pathways in cancer, Proteoglycans in cancer, Autoimmune thyroid disease, Allograft rejection, Graft-versus-host disease, Lipid and atherosclerosis |
Gene Ensembl | ENSECAG00000016549, ENSMUSG00000000817, ENSG00000117560, ENSBTAG00000032808, ENSCAFG00845012259, ENSMMUG00000065134 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.