Human ACP1/HAAP/LMW-PTP ORF/cDNA clone-Lentivirus plasmid (NM_007099)

Cat. No.: pGMLP000524
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ACP1/HAAP/LMW-PTP Lentiviral expression plasmid for ACP1 lentivirus packaging, ACP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to ACP1/HAAP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000524
Gene Name ACP1
Accession Number NM_007099
Gene ID 52
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 477 bp
Gene Alias HAAP,LMW-PTP,LMWPTP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGAACAGGCTACCAAGTCCGTGCTGTTTGTGTGTCTGGGTAACATTTGTCGATCACCCATTGCAGAAGCAGTTTTCAGGAAACTTGTAACCGATCAAAACATCTCAGAGAATTGGGTCATTGACAGCGGTGCTGTTTCTGACTGGAACGTGGGCCGGTCCCCAGACCCAAGAGCTGTGAGCTGCCTAAGAAATCATGGCATTCACACAGCCCATAAAGCAAGACAGATTACCAAAGAAGATTTTGCCACATTTGATTATATACTATGTATGGATGAAAGCAATCTGAGAGATTTGAATAGAAAAAGTAATCAAGTTAAAACCTGCAAAGCTAAAATTGAACTACTTGGGAGCTATGATCCACAAAAACAACTTATTATTGAAGATCCCTATTATGGGAATGACTCTGACTTTGAGACGGTGTACCAGCAGTGTGTCAGGTGCTGCAGAGCGTTCTTGGAGAAGGCCCACTGA
ORF Protein Sequence MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0296-Ab Anti-ACP1 monoclonal antibody
    Target Antigen GM-Tg-g-IP0296-Ag ACP1 protein
    ORF Viral Vector pGMLP000524 Human ACP1 Lentivirus plasmid
    ORF Viral Vector pGMAP000201 Human ACP1 Adenovirus plasmid
    ORF Viral Vector vGMLP000524 Human ACP1 Lentivirus particle
    ORF Viral Vector vGMAP000201 Human ACP1 Adenovirus particle


    Target information

    Target ID GM-IP0296
    Target Name ACP1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    52
    Gene ID 100057408 (Equus caballus), 101092352 (Felis catus), 11431 (Mus musculus), 24161 (Rattus norvegicus)
    280977 (Bos taurus), 52 (Homo sapiens), 606814 (Canis lupus familiaris), 721397 (Macaca mulatta)
    Gene Symbols & Synonyms ACP1,Acp1,Acp-1,Lmptp,LMW-PTP,4632432E04Rik,HAAP,LMWPTP
    Target Alternative Names ACP1,Low molecular weight phosphotyrosine protein phosphatase,LMW-PTP, LMW-PTPase,Adipocyte acid phosphatase, Low molecular weight cytosolic acid phosphatase, Red cell acid phosphatase 1,HAAP,LMWPTP,LMW-PTP
    Uniprot Accession P11064,P24666,P41498,Q9D358
    Additional SwissProt Accessions: Q9D358,P41498,P11064,P24666
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG Metabolic pathways, Adherens junction
    Gene Ensembl ENSECAG00000010079, ENSMUSG00000044573, ENSG00000143727, ENSCAFG00845016946, ENSMMUG00000017097
    Target Classification Kinase


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.