Human CD247/CD3-ZETA/CD3H ORF/cDNA clone-Lentivirus plasmid (NM_198053)

Cat. No.: pGMLP000498
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CD247/CD3-ZETA/CD3H Lentiviral expression plasmid for CD247 lentivirus packaging, CD247 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CD247/CD3-ZETA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000498
Gene Name CD247
Accession Number NM_198053
Gene ID 919
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 495 bp
Gene Alias CD3-ZETA,CD3H,CD3Q,CD3Z,IMD25,T3Z,TCRZ
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGTGGAAGGCGCTTTTCACCGCGGCCATCCTGCAGGCACAGTTGCCGATTACAGAGGCACAGAGCTTTGGCCTGCTGGATCCCAAACTCTGCTACCTGCTGGATGGAATCCTCTTCATCTATGGTGTCATTCTCACTGCCTTGTTCCTGAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCTAA
ORF Protein Sequence MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0204-Ab Anti-CD3Z/ CD247/ CD3-ZETA monoclonal antibody
    Target Antigen GM-Tg-g-MP0204-Ag CD247 VLP (virus-like particle)
    ORF Viral Vector pGMLP000498 Human CD247 Lentivirus plasmid
    ORF Viral Vector pGMAP000002 Human CD247 Adenovirus plasmid
    ORF Viral Vector vGMLP000498 Human CD247 Lentivirus particle
    ORF Viral Vector vGMAP000002 Human CD247 Adenovirus particle


    Target information

    Target ID GM-MP0204
    Target Name CD247
    Gene Group Identifier
    (Target Gene ID in Homo species)
    919
    Gene ID 100051432 (Equus caballus), 101080604 (Felis catus), 12503 (Mus musculus), 25300 (Rattus norvegicus)
    281056 (Bos taurus), 611571 (Canis lupus familiaris), 697814 (Macaca mulatta), 919 (Homo sapiens)
    Gene Symbols & Synonyms CD247,Cd247,Cd3,T3z,Cd3h,Cd3z,Tcrk,Tcrz,Cd3-eta,Cd3zeta,Cd3-zeta,4930549J05Rik,A430104F18Rik,TCRzeta,CD3Z,T3Z,CD3H,CD3Q,TCRZ,IMD25,CD3ZETA,CD3-ZETA
    Target Alternative Names CD247,T-cell surface glycoprotein CD3 zeta chain,T-cell receptor T3 zeta chain,T3Z,CD3H,CD3Q,CD3Z,TCRZ,IMD25,CD3ZETA,CD3-ZETA
    Uniprot Accession P20963,P24161
    Additional SwissProt Accessions: P24161,P20963
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG Natural killer cell mediated cytotoxicity, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, Chagas disease, Epstein-Barr virus infection, PD-L1 expression and PD-1 checkpoint pathway in cancer
    Gene Ensembl ENSECAG00000020158, ENSMUSG00000005763, ENSBTAG00000012700, ENSCAFG00845003466, ENSG00000198821
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.