Human IFNG/IFG/IFI ORF/cDNA clone-Lentivirus plasmid (NM_000619)
Cat. No.: pGMLP000461
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IFNG/IFG/IFI Lentiviral expression plasmid for IFNG lentivirus packaging, IFNG lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
IFN-gamma/IFNG/IFNG/IFG products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP000461 |
Gene Name | IFNG |
Accession Number | NM_000619 |
Gene ID | 3458 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 501 bp |
Gene Alias | IFG,IFI |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAAATATACAAGTTATATCTTGGCTTTTCAGCTCTGCATCGTTTTGGGTTCTCTTGGCTGTTACTGCCAGGACCCATATGTAAAAGAAGCAGAAAACCTTAAGAAATATTTTAATGCAGGTCATTCAGATGTAGCGGATAATGGAACTCTTTTCTTAGGCATTTTGAAGAATTGGAAAGAGGAGAGTGACAGAAAAATAATGCAGAGCCAAATTGTCTCCTTTTACTTCAAACTTTTTAAAAACTTTAAAGATGACCAGAGCATCCAAAAGAGTGTGGAGACCATCAAGGAAGACATGAATGTCAAGTTTTTCAATAGCAACAAAAAGAAACGAGATGACTTCGAAAAGCTGACTAATTATTCGGTAACTGACTTGAATGTCCAACGCAAAGCAATACATGAACTCATCCAAGTGATGGCTGAACTGTCGCCAGCAGCTAAAACAGGGAAGCGAAAAAGGAGTCAGATGCTGTTTCGAGGTCGAAGAGCATCCCAGTAA |
ORF Protein Sequence | MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Biosimilar | GMP-Bios-ab-175 | Pre-Made Emapalumab biosimilar, Whole mAb, Anti-IFNG Antibody: Anti-IFG/IFI/IMD69 therapeutic antibody |
Biosimilar | GMP-Bios-ab-219 | Pre-Made Fontolizumab biosimilar, Whole mAb, Anti-IFNG Antibody: Anti-IFG/IFI/IMD69 therapeutic antibody |
Target Antibody | GM-Tg-g-T77664-Ab | Anti-IFNG/ IFG/ IFI functional antibody |
Target Antigen | GM-Tg-g-T77664-Ag | IFNG protein |
Cytokine | cks-Tg-g-GM-T77664 | interferon, gamma (IFNG) protein & antibody |
ORF Viral Vector | pGMLP000461 | Human IFNG Lentivirus plasmid |
ORF Viral Vector | pGMAD000575 | Human IFNG Adenovirus plasmid |
ORF Viral Vector | pGMAP000297 | Human IFNG Adenovirus plasmid |
ORF Viral Vector | pGMPC004769 | Human IFNG Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP000461 | Human IFNG Lentivirus particle |
ORF Viral Vector | vGMAD000575 | Human IFNG Adenovirus particle |
ORF Viral Vector | vGMAP000297 | Human IFNG Adenovirus particle |
Target information
Target ID | GM-T77664 |
Target Name | IFN-gamma/IFNG |
Gene Group Identifier (Target Gene ID in Homo species) |
3458 |
Gene ID |
100034181 (Equus caballus), 15978 (Mus musculus), 25712 (Rattus norvegicus), 281237 (Bos taurus) 3458 (Homo sapiens), 403801 (Canis lupus familiaris), 493965 (Felis catus), 574282 (Macaca mulatta) |
Gene Symbols & Synonyms | IFNG,Ifng,IF2F,Ifg,If2f,IFN-g,IFNG2,IFG,IFI,IMD69,IFN-G,IFN-gamma |
Target Alternative Names | IFN-gamma, IFNG,Interferon gamma,IFN-gamma,Immune interferon,IFG,IFI,IMD69 |
Uniprot Accession |
P01579,P01580,P01581,P07353,P42160,P42161,P46402,P63310
Additional SwissProt Accessions: P42160,P01580,P01581,P07353,P01579,P42161,P46402,P63310 |
Uniprot Entry Name | |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target, Diagnostics Biomarker, Immuno-oncology Target, INN Index, Cytokine Target |
Disease | cancer, Breast Cancer |
Disease from KEGG | Cytokine-cytokine receptor interaction, HIF-1 signaling pathway, TGF-beta signaling pathway, Osteoclast differentiation, Antigen processing and presentation, JAK-STAT signaling pathway, Natural killer cell mediated cytotoxicity, IL-17 signaling pathway, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, Type I diabetes mellitus, Leishmaniasis, Chagas disease, African trypanosomiasis, Malaria, Toxoplasmosis, Amoebiasis, Tuberculosis, Hepatitis C, Influenza A, Pathways in cancer, PD-L1 expression and PD-1 checkpoint pathway in cancer, Inflammatory bowel disease, Rheumatoid arthritis, Allograft rejection, Graft-versus-host disease, Fluid shear stress and atherosclerosis |
Gene Ensembl | ENSECAG00000028288, ENSMUSG00000055170, ENSBTAG00000012529, ENSG00000111537, ENSCAFG00845013680, ENSMMUG00000056408 |
Target Classification | Cytokine Receptor, Checkpoint-Immuno Oncology |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.