Human PRDX4/AOE37-2/AOE372 ORF/cDNA clone-Lentivirus plasmid (NM_006406)
Cat. No.: pGMLP000443
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human PRDX4/AOE37-2/AOE372 Lentiviral expression plasmid for PRDX4 lentivirus packaging, PRDX4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
PRDX4/AOE37-2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP000443 |
Gene Name | PRDX4 |
Accession Number | NM_006406 |
Gene ID | 10549 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 816 bp |
Gene Alias | AOE37-2,AOE372,HEL-S-97n,PRX-4 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGAGGCGCTGCCGCTGCTAGCCGCGACAACTCCGGACCACGGCCGCCACCGAAGGCTGCTTCTGCTGCCGCTACTGCTGTTCCTGCTGCCGGCTGGAGCTGTGCAGGGCTGGGAGACAGAGGAGAGGCCCCGGACTCGCGAAGAGGAGTGCCACTTCTACGCGGGTGGACAAGTGTACCCGGGAGAGGCATCCCGGGTATCGGTCGCCGACCACTCCCTGCACCTAAGCAAAGCGAAGATTTCCAAGCCAGCGCCCTACTGGGAAGGAACAGCTGTGATCGATGGAGAATTTAAGGAGCTGAAGTTAACTGATTATCGTGGGAAATACTTGGTTTTCTTCTTCTACCCACTTGATTTCACATTTGTGTGTCCAACTGAAATTATCGCTTTTGGCGACAGACTTGAAGAATTCAGATCTATAAATACTGAAGTGGTAGCATGCTCTGTTGATTCACAGTTTACCCATTTGGCCTGGATTAATACCCCTCGAAGACAAGGAGGACTTGGGCCAATAAGGATTCCACTTCTTTCAGATTTGACCCATCAGATCTCAAAGGACTATGGTGTATACCTAGAGGACTCAGGCCACACTCTTAGAGGTCTCTTCATTATTGATGACAAAGGAATCCTAAGACAAATTACTCTGAATGATCTTCCTGTGGGTAGATCAGTGGATGAGACACTACGTTTGGTTCAAGCATTCCAGTACACTGACAAACACGGAGAAGTCTGCCCTGCTGGCTGGAAACCTGGTAGTGAAACAATAATCCCAGATCCAGCTGGAAAGCTGAAGTATTTCGATAAACTGAATTGA |
ORF Protein Sequence | MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T76888-Ab | Anti-PRDX4/ AOE37-2/ AOE372 functional antibody |
Target Antigen | GM-Tg-g-T76888-Ag | PRDX4 protein |
ORF Viral Vector | pGMLP000443 | Human PRDX4 Lentivirus plasmid |
ORF Viral Vector | vGMLP000443 | Human PRDX4 Lentivirus particle |
Target information
Target ID | GM-T76888 |
Target Name | PRDX4 |
Gene Group Identifier (Target Gene ID in Homo species) |
10549 |
Gene ID |
100059985 (Equus caballus), 101093082 (Felis catus), 10549 (Homo sapiens), 119868403 (Canis lupus familiaris) 281999 (Bos taurus), 53381 (Mus musculus), 697635 (Macaca mulatta), 85274 (Rattus norvegicus) |
Gene Symbols & Synonyms | PRDX4,Prdx4,PRX-4,AOE372,AOE37-2,HEL-S-97n,Prx4,TRANK,Prx-iv |
Target Alternative Names | PRDX4,Peroxiredoxin-4,Antioxidant enzyme AOE372 (AOE37-2), Peroxiredoxin IV (Prx-IV), Thioredoxin peroxidase AO372, Thioredoxin-dependent peroxide reductase A0372, Thioredoxin-dependent peroxiredoxin 4,PRX-4,AOE372,AOE37-2,HEL-S-97n |
Uniprot Accession |
O08807,Q13162,Q9BGI2,Q9Z0V5
Additional SwissProt Accessions: Q13162,Q9BGI2,O08807,Q9Z0V5 |
Uniprot Entry Name | |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target |
Disease | Breast Cancer |
Disease from KEGG | |
Gene Ensembl | ENSECAG00000010085, ENSG00000123131, ENSCAFG00845030129, ENSBTAG00000006165, ENSMUSG00000025289, ENSMMUG00000021366 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.