Human F8/AHF/DXS1253E ORF/cDNA clone-Lentivirus plasmid (NM_019863)

Cat. No.: pGMLP000410
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human F8/AHF/DXS1253E Lentiviral expression plasmid for F8 lentivirus packaging, F8 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to F8/AHF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $462.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000410
Gene Name F8
Accession Number NM_019863
Gene ID 2157
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 651 bp
Gene Alias AHF,DXS1253E,F8B,F8C,FVIII,HEMA
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGGATCCAAGACCCTGGGAAGGTCTTCTTTGGCAATGTGGATTCATCTGGGATAAAACACAATATTTTTAACCCTCCAATTATTGCTCGATACATCCGTTTGCACCCAACTCATTATAGCATTCGCAGCACTCTTCGCATGGAGTTGATGGGCTGTGATTTAAATAGTTGCAGCATGCCATTGGGAATGGAGAGTAAAGCAATATCAGATGCACAGATTACTGCTTCATCCTACTTTACCAATATGTTTGCCACCTGGTCTCCTTCAAAAGCTCGACTTCACCTCCAAGGGAGGAGTAATGCCTGGAGACCTCAGGTGAATAATCCAAAAGAGTGGCTGCAAGTGGACTTCCAGAAGACAATGAAAGTCACAGGAGTAACTACTCAGGGAGTAAAATCTCTGCTTACCAGCATGTATGTGAAGGAGTTCCTCATCTCCAGCAGTCAAGATGGCCATCAGTGGACTCTCTTTTTTCAGAATGGCAAAGTAAAGGTTTTTCAGGGAAATCAAGACTCCTTCACACCTGTGGTGAACTCTCTAGACCCACCGTTACTGACTCGCTACCTTCGAATTCACCCCCAGAGTTGGGTGCACCAGATTGCCCTGAGGATGGAGGTTCTGGGCTGCGAGGCACAGGACCTCTACTGA
ORF Protein Sequence MRIQDPGKVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-INN-934 Pre-Made Omfiloctocog Alfa Biosimilar, Recombinant Protein targeting F8: Recombinant therapeutic protein targeting AHF/F8B/F8C/HEMA/FVIII/DXS1253E
    Biosimilar GMP-Bios-INN-809 Pre-Made Efanesoctocog Alfa Biosimilar, Fusion Protein targeting F8 fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting AHF/F8B/F8C/HEMA/FVIII/DXS1253E
    Biosimilar GMP-Bios-INN-823 Pre-Made Efmoroctocog Alfa Biosimilar, Fusion Protein targeting F8 fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting AHF/F8B/F8C/HEMA/FVIII/DXS1253E
    Target Antibody GM-Tg-g-T14602-Ab Anti-FA8/ F8/ AHF monoclonal antibody
    Target Antigen GM-Tg-g-T14602-Ag F8 VLP (virus-like particle)
    ORF Viral Vector pGMLP000410 Human F8 Lentivirus plasmid
    ORF Viral Vector pGMAD000412 Human F8 Adenovirus plasmid
    ORF Viral Vector pGMAP000016 Human F8 Adenovirus plasmid
    ORF Viral Vector vGMLP000410 Human F8 Lentivirus particle
    ORF Viral Vector vGMAD000412 Human F8 Adenovirus particle
    ORF Viral Vector vGMAP000016 Human F8 Adenovirus particle


    Target information

    Target ID GM-T14602
    Target Name F8
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2157
    Gene ID 100063026 (Equus caballus), 100271720 (Bos taurus), 100424151 (Macaca mulatta), 101092751 (Felis catus)
    14069 (Mus musculus), 2157 (Homo sapiens), 302470 (Rattus norvegicus), 403875 (Canis lupus familiaris)
    Gene Symbols & Synonyms F8,Cf8,Cf-8,FVIII,AHF,F8B,F8C,HEMA,THPH13,DXS1253E
    Target Alternative Names F8,Coagulation factor VIII,Antihemophilic factor (AHF), Procoagulant component,AHF,F8B,F8C,HEMA,FVIII,THPH13,DXS1253E
    Uniprot Accession O18806,P00451,Q06194
    Additional SwissProt Accessions: Q06194,P00451,O18806
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, INN Index
    Disease
    Disease from KEGG Complement and coagulation cascades
    Gene Ensembl ENSECAG00000015044, ENSBTAG00000010726, ENSMMUG00000010245, ENSMUSG00000031196, ENSG00000185010, ENSCAFG00845030098
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.