Human S100A6/2A9/5B10 ORF/cDNA clone-Lentivirus plasmid (NM_014624)
Cat. No.: pGMLP000396
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human S100A6/2A9/5B10 Lentiviral expression plasmid for S100A6 lentivirus packaging, S100A6 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
S100A6/2A9 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP000396 |
Gene Name | S100A6 |
Accession Number | NM_014624 |
Gene ID | 6277 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 273 bp |
Gene Alias | 2A9,5B10,CABP,CACY,PRA,S10A6 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCATGCCCCCTGGATCAGGCCATTGGCCTCCTCGTGGCCATCTTCCACAAGTACTCCGGCAGGGAGGGTGACAAGCACACCCTGAGCAAGAAGGAGCTGAAGGAGCTGATCCAGAAGGAGCTCACCATTGGCTCGAAGCTGCAGGATGCTGAAATTGCAAGGCTGATGGAAGACTTGGACCGGAACAAGGACCAGGAGGTGAACTTCCAGGAGTATGTCACCTTCCTGGGGGCCTTGGCTTTGATCTACAATGAAGCCCTCAAGGGCTGA |
ORF Protein Sequence | MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T68513-Ab | Anti-S10A6/ S100A6/ 2A9 monoclonal antibody |
Target Antigen | GM-Tg-g-T68513-Ag | S100A6 VLP (virus-like particle) |
ORF Viral Vector | pGMLP000396 | Human S100A6 Lentivirus plasmid |
ORF Viral Vector | pGMLV002374 | Human S100A6 Lentivirus plasmid |
ORF Viral Vector | pGMPC001633 | Human S100A6 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP000396 | Human S100A6 Lentivirus particle |
ORF Viral Vector | vGMLV002374 | Human S100A6 Lentivirus particle |
Target information
Target ID | GM-T68513 |
Target Name | S100A6 |
Gene Group Identifier (Target Gene ID in Homo species) |
6277 |
Gene ID |
100033887 (Equus caballus), 101083651 (Felis catus), 20200 (Mus musculus), 480143 (Canis lupus familiaris) 6277 (Homo sapiens), 715169 (Macaca mulatta), 85247 (Rattus norvegicus) |
Gene Symbols & Synonyms | S100A6,S100a6,CACY,2A9,PRA,5B10,Cacy,CALCYCLIN,CABP,S10A6 |
Target Alternative Names | S100A6,Protein S100-A6,Calcyclin, Growth factor-inducible protein 2A9, MLN 4, Prolactin receptor-associated protein (PRA), S100 calcium-binding protein A6,2A9,PRA,5B10,CABP,CACY,S10A6 |
Uniprot Accession |
O77691,P05964,P06703,P14069
Additional SwissProt Accessions: O77691,P14069,P06703,P05964 |
Uniprot Entry Name | |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | cancer, Breast Cancer, Congenital occlusion of ureteropelvic junction, Gastrointestinal system cancer |
Disease from KEGG | |
Gene Ensembl | ENSMUSG00000001025, ENSG00000197956, ENSMMUG00000008917 |
Target Classification | Nuclear Receptors |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.