Human ATP6V0C/ATP6C/ATP6L ORF/cDNA clone-Lentivirus plasmid (NM_001694)

Cat. No.: pGMLP000338
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ATP6V0C/ATP6C/ATP6L Lentiviral expression plasmid for ATP6V0C lentivirus packaging, ATP6V0C lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to ATP6V0C/ATP6C products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000338
Gene Name ATP6V0C
Accession Number NM_001694
Gene ID 527
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 468 bp
Gene Alias ATP6C,ATP6L,ATPL,VATL,Vma3,VPPC
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCCGAGTCCAAGAGCGGCCCCGAGTATGCTTCGTTTTTCGCCGTCATGGGCGCCTCGGCCGCCATGGTCTTCAGCGCCCTGGGCGCTGCCTATGGCACAGCCAAGAGCGGTACCGGCATTGCGGCCATGTCTGTCATGCGGCCGGAGCAGATCATGAAGTCCATCATCCCAGTGGTCATGGCTGGCATCATCGCCATCTACGGCCTGGTGGTGGCAGTCCTCATCGCCAACTCCCTGAATGACGACATCAGCCTCTACAAGAGCTTCCTCCAGCTGGGCGCCGGCCTGAGCGTGGGCCTGAGCGGCCTGGCAGCCGGCTTTGCCATCGGCATCGTGGGGGACGCTGGCGTGCGGGGCACCGCCCAGCAGCCCCGACTATTCGTGGGCATGATCCTGATTCTCATCTTCGCCGAGGTGCTCGGCCTCTACGGTCTCATCGTCGCCCTCATCCTCTCCACAAAGTAG
ORF Protein Sequence MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0115-Ab Anti-VATL/ ATP6V0C/ ATP6C monoclonal antibody
    Target Antigen GM-Tg-g-MP0115-Ag ATP6V0C VLP (virus-like particle)
    ORF Viral Vector pGMLP000338 Human ATP6V0C Lentivirus plasmid
    ORF Viral Vector vGMLP000338 Human ATP6V0C Lentivirus particle


    Target information

    Target ID GM-MP0115
    Target Name ATP6V0C
    Gene Group Identifier
    (Target Gene ID in Homo species)
    527
    Gene ID 100065783 (Equus caballus), 100425716 (Macaca mulatta), 101101434 (Felis catus), 11984 (Mus musculus)
    170667 (Rattus norvegicus), 479877 (Canis lupus familiaris), 527 (Homo sapiens), 550622 (Bos taurus)
    Gene Symbols & Synonyms ATP6V0C,Atp6v0c,Atpl,PL16,VATL,Vma3,Atp6c,Atp6l,Atp6c2,Atpl-rs1,ATPL,VPPC,ATP6C,ATP6L,EPEO3,PLP
    Target Alternative Names ATP6C,ATP6L,ATP6V0C,ATPL,Atp6c,Atp6c2,Atp6l,Atp6v0c,Atpl,Atpl-rs1,EPEO3,PL16,PLP,V-ATPase 16 kDa proteolipid subunit c,V-type proton ATPase 16 kDa proteolipid subunit c,VATL,VPPC,Vacuolar proton pump 16 kDa proteolipid subunit c,Vma3
    Uniprot Accession P23956,P27449,P63081,P63082
    Additional SwissProt Accessions: P63082,P63081,P27449,P23956
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG Metabolic pathways, Lysosome, Phagosome, Epithelial cell signaling in Helicobacter pylori infection, Tuberculosis, Human papillomavirus infection, Rheumatoid arthritis
    Gene Ensembl ENSMUSG00000024121, ENSCAFG00845003893, ENSG00000185883, ENSBTAG00000026428
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.