Human PIGF ORF/cDNA clone-Lentivirus plasmid (NM_002643)

Cat. No.: pGMLP000052
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PIGF/ Lentiviral expression plasmid for PIGF lentivirus packaging, PIGF lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to PIGF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $465
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000052
Gene Name PIGF
Accession Number NM_002643
Gene ID 5281
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 660 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAAGATAACGATATCAAGAGACTACTGTATACCCATCTTTTATGCATATTTTCAATTATCCTAAGTGTCTTCATTCCATCACTCTTCTTGGAGAACTTCTCAATATTGGAAACACACTTGACATGGTTGTGCATCTGTTCTGGTTTTGTAACTGCTGTCAATCTAGTACTATATTTAGTAGTGAAACCAAATACATCCTCTAAAAGAAGTTCATTATCACACAAGGTAACTGGATTTTTGAAATGCTGTATCTACTTTCTTATGTCTTGTTTCTCCTTTCATGTAATTTTTGTTCTGTATGGAGCACCACTGATAGAGTTGGCATTGGAAACATTTTTATTTGCAGTTATTTTGTCTACTTTTACTACTGTGCCTTGCTTATGTTTGTTAGGACCAAACCTCAAAGCATGGCTAAGAGTGTTCAGTAGAAATGGAGTTACATCCATATGGGAGAATAGTCTCCAGATCACTACAATTTCTAGCTTTGTAGGAGCATGGCTTGGAGCACTTCCTATTCCACTGGATTGGGAAAGACCATGGCAGGTATGGCCCATCTCCTGTACGCTTGGAGCGACCTTTGGCTACGTGGCTGGCCTTGTTATTTCACCACTCTGGATATACTGGAATAGAAAGCAACTTACATACAAGAACAATTAA
ORF Protein Sequence MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGFVTAVNLVLYLVVKPNTSSKRSSLSHKVTGFLKCCIYFLMSCFSFHVIFVLYGAPLIELALETFLFAVILSTFTTVPCLCLLGPNLKAWLRVFSRNGVTSIWENSLQITTISSFVGAWLGALPIPLDWERPWQVWPISCTLGATFGYVAGLVISPLWIYWNRKQLTYKNN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1389-Ab Anti-PIGF monoclonal antibody
    Target Antigen GM-Tg-g-IP1389-Ag PIGF protein
    ORF Viral Vector pGMLP000052 Human PIGF Lentivirus plasmid
    ORF Viral Vector vGMLP000052 Human PIGF Lentivirus particle


    Target information

    Target ID GM-IP1389
    Target Name PIGF
    Gene Group Identifier
    （Target Gene ID in Homo species)         		5281
    Gene ID 100053298 (Equus caballus), 101101456 (Felis catus), 18701 (Mus musculus), 474580 (Canis lupus familiaris)
    5281 (Homo sapiens), 681086 (Rattus norvegicus), 714844 (Macaca mulatta), 768015 (Bos taurus)
    Gene Symbols & Synonyms PIGF,Pigf,OORS,RHOQ
    Target Alternative Names PIGF,Phosphatidylinositol-glycan biosynthesis class F protein,PIG-F,GPI11 homolog,OORS
    Uniprot Accession O09101,Q07326
    Additional SwissProt Accessions: O09101,Q07326
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease Breast Cancer
    Disease from KEGG Metabolic pathways, Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    Gene Ensembl ENSECAG00000012487, ENSMUSG00000024145, ENSCAFG00845027939, ENSG00000151665, ENSMMUG00000005389, ENSBTAG00000015719
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.