Human EI24/EPG4/PIG8 ORF/cDNA clone-Lentivirus plasmid (NM_004879)

Cat. No.: pGMLP-atg-015
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human EI24/EPG4/PIG8 Lentiviral expression plasmid for EI24 lentivirus packaging, EI24 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to EI24/EPG4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $586.44
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP-atg-015
Gene Name EI24
Accession Number NM_004879
Gene ID 9538
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1023 bp
Gene Alias EPG4,PIG8,TP53I8
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGACAGTGTCAAAACCTTTCTCCAGGACCTTGCCAGAGGAATCAAAGACTCCATCTGGGGTATTTGTACCATCTCAAAGCTAGATGCTCGAATCCAGCAAAAGAGAGAGGAGCAGCGTCGAAGAAGGGCAAGTAGTGTCTTGGCACAGAGAAGAGCCCAGAGTATAGAGCGGAAGCAAGAGAGTGAGCCACGTATTGTTAGTAGAATTTTCCAGTGTTGTGCTTGGAATGGTGGAGTGTTCTGGTTCAGTCTCCTCTTGTTTTATCGAGTATTTATTCCTGTGCTTCAGTCGGTAACAGCCCGAATTATCGGTGACCCATCACTACATGGAGATGTTTGGTCGTGGCTGGAATTCTTCCTCACGTCAATTTTCAGTGCTCTTTGGGTGCTCCCCTTGTTTGTGCTTAGCAAAGTGGTGAATGCCATTTGGTTTCAGGATATAGCTGACCTGGCATTTGAGGTATCAGGGAGGAAGCCTCACCCATTCCCTAGTGTCAGCAAAATAATTGCTGACATGCTCTTCAACCTTTTGCTGCAGGCTCTTTTCCTCATTCAGGGAATGTTTGTGAGTCTCTTTCCCATCCATCTTGTCGGTCAGCTGGTTAGTCTCCTGCATATGTCCCTTCTCTACTCACTGTACTGCTTTGAATATCGTTGGTTCAATAAAGGAATTGAAATGCACCAGCGGTTGTCTAACATAGAAAGGAATTGGCCTTACTACTTTGGGTTTGGTTTGCCCTTGGCTTTTCTCACAGCAATGCAGTCCTCATATATTATCAGTGGCTGCCTTTTCTCTATCCTCTTTCCTTTATTCATTATCAGCGCCAATGAAGCAAAGACCCCTGGCAAAGCATATCTCTTCCAGTTGCGCCTCTTCTCCTTGGTGGTCTTCTTAAGCAACAGACTCTTCCACAAGACAGTCTACCTGCAGTCGGCCCTGAGCAGCTCTACTTCTGCAGAGAAGTTCCCTTCACCGCATCCGTCGCCTGCCAAACTGAAGGCTACTGCAGGTCACTGA
ORF Protein Sequence MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRIFQCCAWNGGVFWFSLLLFYRVFIPVLQSVTARIIGDPSLHGDVWSWLEFFLTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLLQALFLIQGMFVSLFPIHLVGQLVSLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWPYYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAKTPGKAYLFQLRLFSLVVFLSNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATAGH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0742-Ab Anti-EI24 monoclonal antibody
    Target Antigen GM-Tg-g-IP0742-Ag EI24 protein
    ORF Viral Vector pGMLP001492 Human EI24 Lentivirus plasmid
    ORF Viral Vector pGMLP-atg-015 Human EI24 Lentivirus plasmid
    ORF Viral Vector pGMAP-atg-069 Human EI24 Adenovirus plasmid
    ORF Viral Vector vGMLP001492 Human EI24 Lentivirus particle
    ORF Viral Vector vGMLP-atg-015 Human EI24 Lentivirus particle
    ORF Viral Vector vGMAP-atg-069 Human EI24 Adenovirus particle


    Target information

    Target ID GM-IP0742
    Target Name EI24
    Gene Group Identifier
    （Target Gene ID in Homo species)         		9538
    Gene ID 100064327 (Equus caballus), 101082849 (Felis catus), 13663 (Mus musculus), 300514 (Rattus norvegicus)
    489301 (Canis lupus familiaris), 532527 (Bos taurus), 713226 (Macaca mulatta), 9538 (Homo sapiens)
    Gene Symbols & Synonyms EI24,Ei24,PIG8,EPG4,TP53I8
    Target Alternative Names EI24,Etoposide-induced protein 2.4 homolog,p53-induced gene 8 protein,EPG4,PIG8,TP53I8
    Uniprot Accession O14681,Q08DE5,Q4KM77,Q61070
    Additional SwissProt Accessions: Q61070,Q4KM77,Q08DE5,O14681
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG p53 signaling pathway
    Gene Ensembl ENSECAG00000015861, ENSMUSG00000062762, ENSCAFG00845010949, ENSBTAG00000007202, ENSMMUG00000010009, ENSG00000149547
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.