Human FIS1/CGI-135/TTC11 ORF/cDNA clone-Lentivirus plasmid (NM_016068)

Cat. No.: pGMLP-SPh-093
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FIS1/CGI-135/TTC11 Lentiviral expression plasmid for FIS1 lentivirus packaging, FIS1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to FIS1/CGI-135 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP-SPh-093
Gene Name FIS1
Accession Number NM_016068
Gene ID 51024
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 459 bp
Gene Alias CGI-135,TTC11
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGGCCGTGCTGAACGAGCTGGTGTCTGTGGAGGACCTGCTGAAGTTTGAAAAGAAATTTCAGTCTGAGAAGGCAGCAGGCTCGGTGTCCAAGAGCACGCAGTTTGAGTACGCCTGGTGCCTGGTGCGGAGCAAGTACAATGATGACATCCGTAAAGGCATCGTGCTGCTCGAGGAGCTGCTGCCCAAAGGGAGCAAGGAGGAACAGCGGGATTACGTCTTCTACCTGGCCGTGGGGAACTACCGGCTCAAGGAATACGAGAAGGCCTTAAAGTACGTCCGCGGGTTGCTGCAGACAGAGCCCCAGAACAACCAGGCCAAGGAACTGGAGCGGCTCATTGACAAGGCCATGAAGAAAGATGGACTCGTGGGCATGGCCATCGTGGGAGGCATGGCCCTGGGTGTGGCGGGACTGGCCGGACTCATCGGACTTGCTGTGTCCAAGTCCAAATCCTGA
ORF Protein Sequence MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0847-Ab Anti-FIS1 monoclonal antibody
    Target Antigen GM-Tg-g-IP0847-Ag FIS1 protein
    ORF Viral Vector pGMLP002675 Human FIS1 Lentivirus plasmid
    ORF Viral Vector pGMAD000275 Human FIS1 Adenovirus plasmid
    ORF Viral Vector pGMLP-SPh-093 Human FIS1 Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-233 Human FIS1 Adenovirus plasmid
    ORF Viral Vector vGMLP002675 Human FIS1 Lentivirus particle
    ORF Viral Vector vGMAD000275 Human FIS1 Adenovirus particle
    ORF Viral Vector vGMLP-SPh-093 Human FIS1 Lentivirus particle
    ORF Viral Vector vGMAP-SPh-233 Human FIS1 Adenovirus particle


    Target information

    Target ID GM-IP0847
    Target Name FIS1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		51024
    Gene ID 100059592 (Equus caballus), 101081944 (Felis catus), 288584 (Rattus norvegicus), 479728 (Canis lupus familiaris)
    51024 (Homo sapiens), 615565 (Bos taurus), 66437 (Mus musculus), 714444 (Macaca mulatta)
    Gene Symbols & Synonyms FIS1,Fis1,Ttc11,TTC11,CGI-135,2010003O14Rik
    Target Alternative Names FIS1,Mitochondrial fission 1 protein,FIS1 homolog (hFis1), Tetratricopeptide repeat protein 11 (TPR repeat protein 11),TTC11,CGI-135
    Uniprot Accession P84817,Q3T0I5,Q9CQ92,Q9Y3D6
    Additional SwissProt Accessions: P84817,Q9Y3D6,Q3T0I5,Q9CQ92
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000013191, ENSCAFG00845005056, ENSG00000214253, ENSMUSG00000019054, ENSMMUG00000052148
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.