Human IL37/FIL1/FIL1(ZETA) ORF/cDNA clone-Lentivirus plasmid (NM_014439)
Cat. No.: pGMLP-IL-043
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IL37/FIL1/FIL1(ZETA) Lentiviral expression plasmid for IL37 lentivirus packaging, IL37 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
IL-1F7/IL-37/IL37/IL37/FIL1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP-IL-043 |
| Gene Name | IL37 |
| Accession Number | NM_014439 |
| Gene ID | 27178 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 657 bp |
| Gene Alias | FIL1,FIL1(ZETA),FIL1Z,IL-1F7,IL-1H,IL-1H4,IL-1RP1,IL-37,IL1F7,IL1H4,IL1RP1 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTCCTTTGTGGGGGAGAACTCAGGAGTGAAAATGGGCTCTGAGGACTGGGAAAAAGATGAACCCCAGTGCTGCTTAGAAGACCCGGCTGGAAGCCCCCTGGAACCAGGCCCAAGCCTCCCCACCATGAATTTTGTTCACACAAGTCCAAAGGTGAAGAACTTAAACCCGAAGAAATTCAGCATTCATGACCAGGATCACAAAGTACTGGTCCTGGACTCTGGGAATCTCATAGCAGTTCCAGATAAAAACTACATACGCCCAGAGATCTTCTTTGCATTAGCCTCATCCTTGAGCTCAGCCTCTGCGGAGAAAGGAAGTCCGATTCTCCTGGGGGTCTCTAAAGGGGAGTTTTGTCTCTACTGTGACAAGGATAAAGGACAAAGTCATCCATCCCTTCAGCTGAAGAAGGAGAAACTGATGAAGCTGGCTGCCCAAAAGGAATCAGCACGCCGGCCCTTCATCTTTTATAGGGCTCAGGTGGGCTCCTGGAACATGCTGGAGTCGGCGGCTCACCCCGGATGGTTCATCTGCACCTCCTGCAATTGTAATGAGCCTGTTGGGGTGACAGATAAATTTGAGAACAGGAAACACATTGAATTTTCATTTCAACCAGTTTGCAAAGCTGAAATGAGCCCCAGTGAGGTCAGCGATTAG |
| ORF Protein Sequence | MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T96845-Ab | Anti-IL37/ FIL1/ FIL1(ZETA) functional antibody |
| Target Antigen | GM-Tg-g-T96845-Ag | IL37 protein |
| Cytokine | cks-Tg-g-GM-T96845 | interleukin 37 (IL37) protein & antibody |
| ORF Viral Vector | pGMLV000120 | Human IL37 Lentivirus plasmid |
| ORF Viral Vector | pGMAAV000475 | Human IL37 Adeno-associate virus(AAV) plasmid |
| ORF Viral Vector | pGMAP000269 | Human IL1F7 Adenovirus plasmid |
| ORF Viral Vector | pGMLP-IL-043 | Human IL37 Lentivirus plasmid |
| ORF Viral Vector | pGMAP-IL-126 | Human IL37 Adenovirus plasmid |
| ORF Viral Vector | vGMLV000120 | Human IL37 Lentivirus particle |
| ORF Viral Vector | vGMAAV000475 | Human IL37 Adeno-associate virus(AAV) particle |
| ORF Viral Vector | vGMAP000269 | Human IL1F7 Adenovirus particle |
| ORF Viral Vector | vGMLP-IL-043 | Human IL37 Lentivirus particle |
| ORF Viral Vector | vGMAP-IL-126 | Human IL37 Adenovirus particle |
Target information
| Target ID | GM-T96845 |
| Target Name | IL-1F7/IL-37/IL37 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
27178 |
| Gene ID |
100052470 (Equus caballus), 100686057 (Canis lupus familiaris), 27178 (Homo sapiens), 700579 (Macaca mulatta) 786493 (Bos taurus) |
| Gene Symbols & Synonyms | IL37,FIL1,FIL1Z,IL-1H,IL-23,IL-37,IL1F7,IL1H4,IL-1F7,IL-1H4,IL1RP1,IL-1RP1,FIL1(ZETA) |
| Target Alternative Names | FIL1,FIL1 zeta,FIL1(ZETA),FIL1Z,IL-1F7,IL-1H,IL-1H4,IL-1H4),IL-1RP1,IL-1X,IL-23,IL-37,IL1F7,IL1H4,IL1RP1,IL37,Interleukin-1 family member 7 (IL-1F7),Interleukin-1 homolog 4 (IL-1H,Interleukin-1 zeta (IL-1 zeta),Interleukin-1-related protein (IL-1RP1),Interleukin-37 |
| Uniprot Accession |
Q9NZH6
Additional SwissProt Accessions: Q9NZH6 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Cytokine Target |
| Disease | |
| Disease from KEGG | Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor |
| Gene Ensembl | ENSECAG00000015732, ENSCAFG00845011516, ENSG00000125571, ENSMMUG00000005922, ENSBTAG00000013675 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


