Human IL36G/IL-1F9/IL-1H1 ORF/cDNA clone-Lentivirus plasmid (NM_019618)

Cat. No.: pGMLP-IL-041
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL36G/IL-1F9/IL-1H1 Lentiviral expression plasmid for IL36G lentivirus packaging, IL36G lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to IL-36 Gamma/IL36G/IL36G/IL-1F9 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $427.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP-IL-041
Gene Name IL36G
Accession Number NM_019618
Gene ID 56300
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 510 bp
Gene Alias IL-1F9,IL-1H1,IL-1RP2,IL1E,IL1F9,IL1H1,IL1RP2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGAGGCACTCCAGGAGACGCTGATGGTGGAGGAAGGGCCGTCTATCAATCAATGTGTAAACCTATTACTGGGACTATTAATGATTTGAATCAGCAAGTGTGGACCCTTCAGGGTCAGAACCTTGTGGCAGTTCCACGAAGTGACAGTGTGACCCCAGTCACTGTTGCTGTTATCACATGCAAGTATCCAGAGGCTCTTGAGCAAGGCAGAGGGGATCCCATTTATTTGGGAATCCAGAATCCAGAAATGTGTTTGTATTGTGAGAAGGTTGGAGAACAGCCCACATTGCAGCTAAAAGAGCAGAAGATCATGGATCTGTATGGCCAACCCGAGCCCGTGAAACCCTTCCTTTTCTACCGTGCCAAGACTGGTAGGACCTCCACCCTTGAGTCTGTGGCCTTCCCGGACTGGTTCATTGCCTCCTCCAAGAGAGACCAGCCCATCATTCTGACTTCAGAACTTGGGAAGTCATACAACACTGCCTTTGAATTAAATATAAATGACTGA
ORF Protein Sequence MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T72514-Ab Anti-IL36G/ IL-1F9/ IL-1H1 monoclonal antibody
    Target Antigen GM-Tg-g-T72514-Ag IL36G VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-T72514 interleukin 36, gamma (IL36G) protein & antibody
    ORF Viral Vector pGMLP003211 Human IL36G Lentivirus plasmid
    ORF Viral Vector pGMLP-IL-041 Human IL36G Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-124 Human IL36G Adenovirus plasmid
    ORF Viral Vector vGMLP003211 Human IL36G Lentivirus particle
    ORF Viral Vector vGMLP-IL-041 Human IL36G Lentivirus particle
    ORF Viral Vector vGMAP-IL-124 Human IL36G Adenovirus particle


    Target information

    Target ID GM-T72514
    Target Name IL-36 Gamma/IL36G
    Gene Group Identifier
    (Target Gene ID in Homo species)
    56300
    Gene ID 100065031 (Equus caballus), 100686137 (Canis lupus familiaris), 101081377 (Felis catus), 215257 (Mus musculus)
    499744 (Rattus norvegicus), 56300 (Homo sapiens), 615762 (Bos taurus), 700822 (Macaca mulatta)
    Gene Symbols & Synonyms IL36G,Il36g,If36g,Il1f9,IL-36gamma,RGD1563019,IL1E,IL1F9,IL1H1,IL-1F9,IL-1H1,IL1RP2,IL-1RP2
    Target Alternative Names IL-36 Gamma, IL36G,Interleukin-36 gamma,IL-1-related protein 2 (IL-1RP2), Interleukin-1 epsilon (IL-1 epsilon), Interleukin-1 family member 9 (IL-1F9), Interleukin-1 homolog 1 (IL-1H1),IL1E,IL1F9,IL1H1,IL-1F9,IL-1H1,IL1RP2,IL-1RP2
    Uniprot Accession Q8R460,Q9NZH8
    Additional SwissProt Accessions: Q8R460,Q9NZH8
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction
    Gene Ensembl ENSECAG00000059103, ENSCAFG00845011516, ENSMUSG00000044103, ENSG00000136688, ENSBTAG00000002085, ENSMMUG00000062948
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.