Human IL36A/FIL1/FIL1(EPSILON) ORF/cDNA clone-Lentivirus plasmid (NM_014440)
Cat. No.: pGMLP-IL-039
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IL36A/FIL1/FIL1(EPSILON) Lentiviral expression plasmid for IL36A lentivirus packaging, IL36A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
IL-1F6/IL-36 Alpha/IL36A/IL36A/FIL1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP-IL-039 |
| Gene Name | IL36A |
| Accession Number | NM_014440 |
| Gene ID | 27179 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 477 bp |
| Gene Alias | FIL1,FIL1(EPSILON),FIL1E,IL-1F6,IL1(EPSILON),IL1F6 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGAAAAAGCATTGAAAATTGACACACCTCAGCAGGGGAGCATTCAGGATATCAATCATCGGGTGTGGGTTCTTCAGGACCAGACGCTCATAGCAGTCCCGAGGAAGGACCGTATGTCTCCAGTCACTATTGCCTTAATCTCATGCCGACATGTGGAGACCCTTGAGAAAGACAGAGGGAACCCCATCTACCTGGGCCTGAATGGACTCAATCTCTGCCTGATGTGTGCTAAAGTCGGGGACCAGCCCACACTGCAGCTGAAGGAAAAGGATATAATGGATTTGTACAACCAACCCGAGCCTGTGAAGTCCTTTCTCTTCTACCACAGCCAGAGTGGCAGGAACTCCACCTTCGAGTCTGTGGCTTTCCCTGGCTGGTTCATCGCTGTCAGCTCTGAAGGAGGCTGTCCTCTCATCCTTACCCAAGAACTGGGGAAAGCCAACACTACTGACTTTGGGTTAACTATGCTGTTTTAA |
| ORF Protein Sequence | MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE1029-Ab | Anti-IL36A/ FIL1/ FIL1(EPSILON) functional antibody |
| Target Antigen | GM-Tg-g-SE1029-Ag | IL36A protein |
| Cytokine | cks-Tg-g-GM-SE1029 | IL-1 F6 (IL36A) protein & antibody |
| ORF Viral Vector | pGMLP-IL-039 | Human IL36A Lentivirus plasmid |
| ORF Viral Vector | pGMAP-IL-122 | Human IL36A Adenovirus plasmid |
| ORF Viral Vector | vGMLP-IL-039 | Human IL36A Lentivirus particle |
| ORF Viral Vector | vGMAP-IL-122 | Human IL36A Adenovirus particle |
Target information
| Target ID | GM-SE1029 |
| Target Name | IL-1F6/IL-36 Alpha/IL36A |
|
Gene Group Identifier (Target Gene ID in Homo species) |
27179 |
| Gene ID | 27179 (Homo sapiens), 296541 (Rattus norvegicus), 705136 (Macaca mulatta) |
| Gene Symbols & Synonyms | IL36A,Il36a,FIL1,FIL1E,IL1F6,IL-1F6,IL1(EPSILON),FIL1(EPSILON),Il1f6 |
| Target Alternative Names | FIL1,FIL1 epsilon,FIL1(EPSILON),FIL1E,IL-1F6,IL-36 Alpha,IL1(EPSILON),IL1F6,IL36A,Il1f6,Il36a,Interleukin-1 epsilon (IL-1 epsilon),Interleukin-1 family member 6 (IL-1F6),Interleukin-36 alpha |
| Uniprot Accession |
Q9UHA7
Additional SwissProt Accessions: Q9UHA7 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Cytokine Target |
| Disease | |
| Disease from KEGG | Cytokine-cytokine receptor interaction |
| Gene Ensembl | ENSG00000136694, ENSMMUG00000000988 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


