Human IL12A/CLMF/IL-12A ORF/cDNA clone-Lentivirus plasmid (NM_000882)

Cat. No.: pGMLP-IL-015
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL12A/CLMF/IL-12A Lentiviral expression plasmid for IL12A lentivirus packaging, IL12A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to IL-12/IL12A/IL12A/CLMF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $490.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP-IL-015
Gene Name IL12A
Accession Number NM_000882
Gene ID 3592
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 762 bp
Gene Alias CLMF,IL-12A,NFSK,NKSF1,P35
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGGCCCCCTGGGTCAGCCTCCCAGCCACCGCCCTCACCTGCCGCGGCCACAGGTCTGCATCCAGCGGCTCGCCCTGTGTCCCTGCAGTGCCGGCTCAGCATGTGTCCAGCGCGCAGCCTCCTCCTTGTGGCTACCCTGGTCCTCCTGGACCACCTCAGTTTGGCCAGAAACCTCCCCGTGGCCACTCCAGACCCAGGAATGTTCCCATGCCTTCACCACTCCCAAAACCTGCTGAGGGCCGTCAGCAACATGCTCCAGAAGGCCAGACAAACTCTAGAATTTTACCCTTGCACTTCTGAAGAGATTGATCATGAAGATATCACAAAAGATAAAACCAGCACAGTGGAGGCCTGTTTACCATTGGAATTAACCAAGAATGAGAGTTGCCTAAATTCCAGAGAGACCTCTTTCATAACTAATGGGAGTTGCCTGGCCTCCAGAAAGACCTCTTTTATGATGGCCCTGTGCCTTAGTAGTATTTATGAAGACTTGAAGATGTACCAGGTGGAGTTCAAGACCATGAATGCAAAGCTTCTGATGGATCCTAAGAGGCAGATCTTTCTAGATCAAAACATGCTGGCAGTTATTGATGAGCTGATGCAGGCCCTGAATTTCAACAGTGAGACTGTGCCACAAAAATCCTCCCTTGAAGAACCGGATTTTTATAAAACTAAAATCAAGCTCTGCATACTTCTTCATGCTTTCAGAATTCGGGCAGTGACTATTGATAGAGTGATGAGCTATCTGAATGCTTCCTAA
ORF Protein Sequence MWPPGSASQPPPSPAAATGLHPAARPVSLQCRLSMCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T13251-Ab Anti-IL12A/ CLMF/ IL-12A functional antibody
    Target Antigen GM-Tg-g-T13251-Ag IL12A protein
    Cytokine cks-Tg-g-GM-T13251 IL-12 p70 (IL12A) protein & antibody
    ORF Viral Vector pGMLV000443 Human IL12A Lentivirus plasmid
    ORF Viral Vector pGMLP-IL-015 Human IL12A Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-098 Human IL12A Adenovirus plasmid
    ORF Viral Vector vGMLV000443 Human IL12A Lentivirus particle
    ORF Viral Vector vGMLP-IL-015 Human IL12A Lentivirus particle
    ORF Viral Vector vGMAP-IL-098 Human IL12A Adenovirus particle


    Target information

    Target ID GM-T13251
    Target Name IL-12/IL12A
    Gene Group Identifier
    (Target Gene ID in Homo species)
    3592
    Gene ID 100034215 (Equus caballus), 16159 (Mus musculus), 281856 (Bos taurus), 3592 (Homo sapiens)
    403977 (Canis lupus familiaris), 493741 (Felis catus), 703205 (Macaca mulatta), 84405 (Rattus norvegicus)
    Gene Symbols & Synonyms IL12A,Il12a,IL-12A,p35,Ll12a,Il-12a,IL-12p35,IL12p35,Il-12 p35,P35,CLMF,NFSK,NKSF1,CLMF p35
    Target Alternative Names CLMF,CLMF p35,Cytotoxic lymphocyte maturation factor 35 kDa subunit (CLMF p35),IL-12,IL-12 subunit p35,IL-12A,IL-12p35,IL12A,IL12p35,Il-12 p35,Il-12a,Il12a,Interleukin-12 subunit alpha,Ll12a,NFSK,NK cell stimulatory factor chain 1 (NKSF1),NKSF1,P35,p35
    Uniprot Accession O02743,P29459,P43431,P48091,P54349,Q28267,Q9R103,Q9XSQ6
    Additional SwissProt Accessions: Q9XSQ6,P43431,P54349,P29459,Q28267,O02743,P48091,Q9R103
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease cancer, malignant glioma
    Disease from KEGG Cytokine-cytokine receptor interaction, Toll-like receptor signaling pathway, RIG-I-like receptor signaling pathway, C-type lectin receptor signaling pathway, JAK-STAT signaling pathway, Th1 and Th2 cell differentiation, Alcoholic liver disease, Type I diabetes mellitus, Pertussis, Legionellosis, Leishmaniasis, Chagas disease, African trypanosomiasis, Malaria, Toxoplasmosis, Amoebiasis, Tuberculosis, Measles, Influenza A, Pathways in cancer, Inflammatory bowel disease, Allograft rejection, Lipid and atherosclerosis
    Gene Ensembl ENSECAG00000024671, ENSMUSG00000027776, ENSBTAG00000015150, ENSG00000168811, ENSCAFG00845026803, ENSMMUG00000023084
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.