Human IL1B/IL-1/IL1-BETA ORF/cDNA clone-Lentivirus plasmid (NM_000576)
Cat. No.: pGMLP-IL-002
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IL1B/IL-1/IL1-BETA Lentiviral expression plasmid for IL1B lentivirus packaging, IL1B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
IL-1 Beta/IL1B/IL1B/IL-1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP-IL-002 |
| Gene Name | IL1B |
| Accession Number | NM_000576 |
| Gene ID | 3553 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 810 bp |
| Gene Alias | IL-1,IL1-BETA,IL1F2 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCAGAAGTACCTGAGCTCGCCAGTGAAATGATGGCTTATTACAGTGGCAATGAGGATGACTTGTTCTTTGAAGCTGATGGCCCTAAACAGATGAAGTGCTCCTTCCAGGACCTGGACCTCTGCCCTCTGGATGGCGGCATCCAGCTACGAATCTCCGACCACCACTACAGCAAGGGCTTCAGGCAGGCCGCGTCAGTTGTTGTGGCCATGGACAAGCTGAGGAAGATGCTGGTTCCCTGCCCACAGACCTTCCAGGAGAATGACCTGAGCACCTTCTTTCCCTTCATCTTTGAAGAAGAACCTATCTTCTTCGACACATGGGATAACGAGGCTTATGTGCACGATGCACCTGTACGATCACTGAACTGCACGCTCCGGGACTCACAGCAAAAAAGCTTGGTGATGTCTGGTCCATATGAACTGAAAGCTCTCCACCTCCAGGGACAGGATATGGAGCAACAAGTGGTGTTCTCCATGTCCTTTGTACAAGGAGAAGAAAGTAATGACAAAATACCTGTGGCCTTGGGCCTCAAGGAAAAGAATCTGTACCTGTCCTGCGTGTTGAAAGATGATAAGCCCACTCTACAGCTGGAGAGTGTAGATCCCAAAAATTACCCAAAGAAGAAGATGGAAAAGCGATTTGTCTTCAACAAGATAGAAATCAATAACAAGCTGGAATTTGAGTCTGCCCAGTTCCCCAACTGGTACATCAGCACCTCTCAAGCAGAAAACATGCCCGTCTTCCTGGGAGGGACCAAAGGCGGCCAGGATATAACTGACTTCACCATGCAATTTGTGTCTTCCTAA |
| ORF Protein Sequence | MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Target information
| Target ID | GM-T42000 |
| Target Name | IL-1 Beta/IL1B |
|
Gene Group Identifier (Target Gene ID in Homo species) |
3553 |
| Gene ID |
16176 (Mus musculus), 24494 (Rattus norvegicus), 281251 (Bos taurus), 3553 (Homo sapiens) 403974 (Canis lupus familiaris), 704701 (Macaca mulatta), 768274 (Felis catus) |
| Gene Symbols & Synonyms | Il1b,IL1B,Il-1b,IL-1beta,IL-1F2,IL-1,IL1F2,IL1beta,IL1-BETA |
| Target Alternative Names | Catabolin,IL-1,IL-1 Beta,IL-1 beta,IL-1F2,IL-1beta,IL1-BETA,IL1B,IL1F2,IL1beta,Il-1b,Il1b,Interleukin-1 beta |
| Uniprot Accession |
P01584,P09428,P10749,P41687,P48090,Q28292,Q63264
Additional SwissProt Accessions: P10749,Q63264,P09428,P01584,Q28292,P48090,P41687 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Immuno-oncology Target, INN Index, Cytokine Target |
| Disease | cancer, Breast Cancer, prostate cancer |
| Disease from KEGG | Antifolate resistance, MAPK signaling pathway, Cytokine-cytokine receptor interaction, NF-kappa B signaling pathway, Osteoclast differentiation, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, C-type lectin receptor signaling pathway, Hematopoietic cell lineage, IL-17 signaling pathway, Th17 cell differentiation, TNF signaling pathway, Inflammatory mediator regulation of TRP channels, AGE-RAGE signaling pathway in diabetic complications, Alcoholic liver disease, Type I diabetes mellitus, Alzheimer disease, Pathogenic Escherichia coli infection, Pertussis, Legionellosis, Yersinia infection, Leishmaniasis, Chagas disease, African trypanosomiasis, Malaria, Amoebiasis, Tuberculosis, Measles, Human cytomegalovirus infection, Influenza A, Inflammatory bowel disease, Rheumatoid arthritis, Graft-versus-host disease, Lipid and atherosclerosis, Fluid shear stress and atherosclerosis |
| Gene Ensembl | ENSMUSG00000027398, ENSBTAG00000001321, ENSG00000125538, ENSCAFG00845011661, ENSMMUG00000061716 |
| Target Classification | Checkpoint-Immuno Oncology |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


