Human TIMP1/EPA/EPO ORF/cDNA clone-Adenovirus plasmid (BC000866)

Cat. No.: pGMAP000553
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TIMP1/EPA/EPO adenoviral expression plasmid for TIMP1 adenovirus packaging, TIMP1 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to TIMP1/EPA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000553
Gene Name TIMP1
Accession Number BC000866
Gene ID 7076
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 624 bp
Gene Alias EPA,EPO,HCI
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCCCCTTTGAGCCCCTGGCTTCTGGCATCCTGTTGTTGCTGTGGCTGATAGCCCCCAGCAGGGCCTGCACCTGTGTCCCACCCCACCCACAGACGGCCTTCTGCAATTCCGACCTCGTCATCAGGGCCAAGTTCGTGGGGACACCAGAAGTCAACCAGACCACCTTATACCAGCGTTATGAGATCAAGATGACCAAGATGTATAAAGGGTTCCAAGCCTTAGGGGATGCCGCTGACATCCGGTTCGTCTACACCCCCGCCATGGAGAGTGTCTGCGGATACTTCCACAGGTCCCACAACCGCAGCGAGGAGTTTCTCATTGCTGGAAAACTGCAGGATGGACTCTTGCACATCACTACCTGCAGTTTCGTGGCTCCCTGGAACAGCCTGAGCTTAGCTCAGCGCCGGGGCTTCACCAAGACCTACACTGTTGGCTGTGAGGAATGCACAGTGTTTCCCTGTTTATCCATCCCCTGCAAACTGCAGAGTGGCACTCATTGCTTGTGGACGGACCAGCTCCTCCAAGGCTCTGAAAAGGGCTTCCAGTCCCGTCACCTTGCCTGCCTGCCTCGGGAGCCAGGGCTGTGCACCTGGCAGTCCCTGCGGTCCCAGATAGCCTGA
ORF Protein Sequence MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0506-Ab Anti-TIMP1/ CLGI/ EPA functional antibody
    Target Antigen GM-Tg-g-SE0506-Ag TIMP1 protein
    ORF Viral Vector pGMLP001347 Human TIMP1 Lentivirus plasmid
    ORF Viral Vector pGMLV000257 Human TIMP1 Lentivirus plasmid
    ORF Viral Vector pGMAP000455 Human TIMP1 Adenovirus plasmid
    ORF Viral Vector pGMAP000469 Human TIMP1 Adenovirus plasmid
    ORF Viral Vector pGMAP000553 Human TIMP1 Adenovirus plasmid
    ORF Viral Vector pGMPC001587 Human TIMP1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP001347 Human TIMP1 Lentivirus particle
    ORF Viral Vector vGMLV000257 Human TIMP1 Lentivirus particle
    ORF Viral Vector vGMAP000455 Human TIMP1 Adenovirus particle
    ORF Viral Vector vGMAP000469 Human TIMP1 Adenovirus particle
    ORF Viral Vector vGMAP000553 Human TIMP1 Adenovirus particle


    Target information

    Target ID GM-SE0506
    Target Name TIMP1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    7076
    Gene ID 100034220 (Equus caballus), 101095886 (Felis catus), 116510 (Rattus norvegicus), 21857 (Mus musculus)
    282092 (Bos taurus), 403816 (Canis lupus familiaris), 574348 (Macaca mulatta), 7076 (Homo sapiens)
    Gene Symbols & Synonyms TIMP1,Timp1,TIMP-1,Timp,EPA,Clgi,TPA-S1,EPO,HCI,CLGI,TIMP
    Target Alternative Names CLGI,Clgi,EPA,EPO,Erythroid-potentiating activity (EPA),Fibroblast collagenase inhibitor (Collagenase inhibitor),HCI,Metalloproteinase inhibitor 1,TIMP,TIMP-1,TIMP1,TPA-S1,Timp,Timp1,Tissue inhibitor of metalloproteinases 1 (TIMP-1)
    Uniprot Accession O02722,P01033,P12032,P20414,P30120,P81546,Q95KL9
    Additional SwissProt Accessions: O02722,P30120,P12032,P20414,P81546,Q95KL9,P01033
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Diagnostics Biomarker
    Disease cancer, Dent disease, Vesicoureteral reflux
    Disease from KEGG HIF-1 signaling pathway
    Gene Ensembl ENSECAG00000014259, ENSMUSG00000001131, ENSBTAG00000066152, ENSCAFG00845030572, ENSMMUG00000011426, ENSG00000102265
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.