Human CD79A/MB-1 ORF/cDNA clone-Adenovirus plasmid (BC113731)

Cat. No.: pGMAP000491
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CD79A/MB-1 adenoviral expression plasmid for CD79A adenovirus packaging, CD79A adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CD79A/CD79a/CD79A/MB-1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000491
Gene Name CD79A
Accession Number BC113731
Gene ID 973
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 681 bp
Gene Alias MB-1
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGCCTGGGGGTCCAGGAGTCCTCCAAGCTCTGCCTGCCACCATCTTCCTCCTCTTCCTGCTGTCTGCTGTCTACCTGGGCCCTGGGTGCCAGGCCCTGTGGATGCACAAGGTCCCAGCATCATTGATGGTGAGCCTGGGGGAAGACGCCCACTTCCAATGCCCGCACAATAGCAGCAACAACGCCAACGTCACCTGGTGGCGCGTCCTCCATGGCAACTACACGTGGCCCCCTGAGTTCTTGGGCCCGGGCGAGGACCCCAATGGTACGCTGATCATCCAGAATGTGAACAAGAGCCATGGGGGCATATACGTGTGCCGGGTCCAGGAGGGCAACGAGTCATACCAGCAGTCCTGCGGCACCTACCTCCGCGTGCGCCAGCCGCCCCCCAGGCCCTTCCTGGACATGGGGGAGGGCACCAAGAACCGAATCATCACAGCCGAGGGGATCATCCTCCTGTTCTGCGCGGTGGTGCCTGGGACGCTGCTGCTGTTCAGGAAACGATGGCAGAACGAGAAGCTCGGGTTGGATGCCGGGGATGAATATGAAGATGAAAACCTTTATGAAGGCCTGAACCTGGACGACTGCTCCATGTATGAGGACATCTCCCGGGGCCTCCAGGGCACCTACCAGGATGTGGGCAGCCTCAACATAGGAGATGTCCAGCTGGAGAAGCCGTGA
ORF Protein Sequence MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0216-Ab Anti-CD79A/ IGA/ MB-1 monoclonal antibody
    Target Antigen GM-Tg-g-MP0216-Ag CD79A VLP (virus-like particle)
    ORF Viral Vector pGMAP000491 Human CD79A Adenovirus plasmid
    ORF Viral Vector vGMAP000491 Human CD79A Adenovirus particle


    Target information

    Target ID GM-MP0216
    Target Name CD79A/CD79a
    Gene Group Identifier
    （Target Gene ID in Homo species)         		973
    Gene ID 100052219 (Equus caballus), 100913063 (Rattus norvegicus), 101083127 (Felis catus), 12518 (Mus musculus)
    281674 (Bos taurus), 484483 (Canis lupus familiaris), 722190 (Macaca mulatta), 973 (Homo sapiens)
    Gene Symbols & Synonyms CD79A,Cd79a,Cd79al,Iga,Ly54,mb-1,Ly-54,Igalpha,Ig-alpha,MB-1,IG-alpha,IGA,MB1,IGAlpha
    Target Alternative Names B-cell antigen receptor complex-associated protein alpha chain,CD79A,CD79a,Cd79a,Cd79al,IG-alpha,IGA,IGAlpha,Ig-alpha,Iga,Igalpha,Ly-54,Ly54,MB-1,MB-1 membrane glycoprotein,MB1,Membrane-bound immunoglobulin-associated protein,Surface IgM-associated protein,mb-1
    Uniprot Accession P0CAN6,P11911,P11912,P40293
    Additional SwissProt Accessions: P11911,P40293,P0CAN6,P11912
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease cancer
    Disease from KEGG B cell receptor signaling pathway
    Gene Ensembl ENSECAG00000007198, ENSMUSG00000003379, ENSBTAG00000001882, ENSCAFG00845001724, ENSMMUG00000047772, ENSG00000105369
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.