Human FKBP1A/FKBP-12/FKBP12 ORF/cDNA clone-Adenovirus plasmid (BC119732)
Cat. No.: pGMAP000487
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human FKBP1A/FKBP-12/FKBP12 adenoviral expression plasmid for FKBP1A adenovirus packaging, FKBP1A adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
FKBP1A/FKBP-12 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAP000487 |
| Gene Name | FKBP1A |
| Accession Number | BC119732 |
| Gene ID | 2280 |
| Species | Human |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 438 bp |
| Gene Alias | FKBP-12,FKBP12,FKBP12C,PKC12,PKCI2,PPIASE |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGGCAGGCAACGCGCTGAGGGACTAGGCAGAGCCGTGGAACCGCCGCCAGGTCGCTGTTGGTCCACGCCGCCCGTCGCGCCGCCCGCCCGCTCAGCGTCCGCCGCCGCCATGGGAGTGCAGGTGGAAACCATCTCCCCAGGAGACGGGCGCACCTTCCCCAAGCGCGGCCAGACCTGCGTGGTGCACTACACCGGGATGCTTGAAGATGGAAAGAAATTTGATTCCTCCCGGGACAGAAACAAGCCCTTTAAGTTTATGCTAGGCAAGCAGGAGGTGATCCGAGGCTGGGAAGAAGGGGTTGCCCAGATGAGTGTGGGTCAGAGAGCCAAACTGACTATATCTCCAGATTATGCCTATGGTGCCACTGGGCACCCAGGCATCATCCCACCACATGCCACTCTCGTCTTCGATGTGGAGCTTCTAAAACTGGAATGA |
| ORF Protein Sequence | MGRQRAEGLGRAVEPPPGRCWSTPPVAPPARSASAAAMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP0019-Ab | Anti-FKBP1A monoclonal antibody |
| Target Antigen | GM-Tg-g-IP0019-Ag | FKBP1A protein |
| ORF Viral Vector | pGMLP000449 | Human FKBP1A Lentivirus plasmid |
| ORF Viral Vector | pGMAP000355 | Human FKBP1A Adenovirus plasmid |
| ORF Viral Vector | pGMAP000487 | Human FKBP1A Adenovirus plasmid |
| ORF Viral Vector | vGMLP000449 | Human FKBP1A Lentivirus particle |
| ORF Viral Vector | vGMAP000355 | Human FKBP1A Adenovirus particle |
| ORF Viral Vector | vGMAP000487 | Human FKBP1A Adenovirus particle |
Target information
| Target ID | GM-IP0019 |
| Target Name | FKBP1A |
|
Gene Group Identifier (Target Gene ID in Homo species) |
2280 |
| Gene ID |
100629541 (Equus caballus), 100686033 (Canis lupus familiaris), 101100379 (Felis catus), 14225 (Mus musculus) 2280 (Homo sapiens), 25639 (Rattus norvegicus), 614795 (Bos taurus), 717385 (Macaca mulatta) |
| Gene Symbols & Synonyms | FKBP1A,Fkbp1a,Fkbp,Fkbp1,FKBP12,FKBP1,PKC12,PKCI2,PPIASE,FKBP-12,FKBP-1A,Fkbp2,FKBP1B |
| Target Alternative Names | 12 kDa FK506-binding protein (12 kDa FKBP,Calstabin-1,FK506-binding protein 1A (FKBP-1A),FKBP-12,FKBP-12),FKBP-1A,FKBP1,FKBP12,FKBP1A,FKBP1B,Fkbp,Fkbp1,Fkbp1a,Fkbp2,Immunophilin FKBP12,PKC12,PKCI2,PPIASE,PPIase FKBP1A,Peptidyl-prolyl cis-trans isomerase FKBP1A,Rotamase |
| Uniprot Accession |
P18203,P26883,P62942,Q62658
Additional SwissProt Accessions: P26883,P62942,Q62658,P18203 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | |
| Disease from KEGG | |
| Gene Ensembl | ENSECAG00000017887, ENSCAFG00845018977, ENSMUSG00000032966, ENSG00000088832, ENSBTAG00000008303, ENSMMUG00000015996 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


