Human CEACAM3/CD66D/CEA ORF/cDNA clone-Adenovirus plasmid (BC106728)

Cat. No.: pGMAP000486
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CEACAM3/CD66D/CEA adenoviral expression plasmid for CEACAM3 adenovirus packaging, CEACAM3 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to CEACAM3/CD66d/CEACAM3/CD66D products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000486
Gene Name CEACAM3
Accession Number BC106728
Gene ID 1084
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 759 bp
Gene Alias CD66D,CEA,W264,W282
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGCCCCCCTCAGCCTCTCCCCACAGAGAATGCATCCCCTGGCAGGGGCTTCTGCTCACAGCCTCACTTCTAAACTTCTGGAACCCGCCCACCACTGCCAAGCTCACTATTGAATCCATGCCGCTCAGTGTCGCAGAGGGGAAGGAGGTGCTTCTACTTGTCCACAATCTGCCCCAGCATCTTTTTGGCTACAGCTGGTACAAAGGGGAAAGAGTGGATGGCAACAGTCTAATTGTAGGATATGTAATAGGAACTCAACAAGCTACCCCAGGGGCCGCATACAGCGGTCGAGAGACAATATACACCAATGCATCCCTGCTGATCCAGAATGTCACCCAGAATGACATAGGATTCTACACCCTACAAGTCATAAAGTCAGATCTTGTGAATGAAGAAGCAACTGGACAGTTCCATGTATACCAAGAAAATGCCCCAGGCCTTCCTGTGGGGGCCGTCGCCGGCATCGTGACCGGGGTCCTGGTCGGAGTGGCGCTGGTGGCCGCGCTGGTGTGTTTCCTGCTCCTTGCCAAAACTGGAAGAACCAGCATCCAGCGTGACCTCAAGGAGCAGCAGCCCCAAGCCCTTGCCCCTGGCCGTGGTCCCTCCCACAGCTCTGCCTTCTCGATGTCCCCTCTCTCCACTGCCCAGGCCCCCCTACCCAACCCCAGGACAGCAGCTTCCATCTATGAGGAATTGCTAAAACATGACACAAACATTTACTGCCGGATGGACCACAAAGCAGAAGTGGCTTCTTAG
ORF Protein Sequence MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGIVTGVLVGVALVAALVCFLLLAKTGRTSIQRDLKEQQPQALAPGRGPSHSSAFSMSPLSTAQAPLPNPRTAASIYEELLKHDTNIYCRMDHKAEVAS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T21890-Ab Anti-CEAM3/ CD66d/ CEACAM3 monoclonal antibody
    Target Antigen GM-Tg-g-T21890-Ag CD66d/CEACAM3 VLP (virus-like particle)
    ORF Viral Vector pGMAP000486 Human CEACAM3 Adenovirus plasmid
    ORF Viral Vector vGMAP000486 Human CEACAM3 Adenovirus particle


    Target information

    Target ID GM-T21890
    Target Name CEACAM3/CD66d
    Gene Group Identifier
    (Target Gene ID in Homo species)
    1084
    Gene ID 1084 (Homo sapiens), 707824 (Macaca mulatta)
    Gene Symbols & Synonyms CEACAM3,CEA,CGM1,W264,W282,CD66D,CGM1a
    Target Alternative Names CEACAM3, CD66d,Cell adhesion molecule CEACAM3,Carcinoembryonic antigen CGM1, Carcinoembryonic antigen-related cell adhesion molecule 3 (CEA cell adhesion molecule 3),CEA,CGM1,W264,W282,CD66D,CGM1a
    Uniprot Accession P40198
    Additional SwissProt Accessions: P40198
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Diagnostics Biomarker, Immuno-oncology Target
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSG00000170956, ENSMMUG00000018103
    Target Classification Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.