Human APOC3/APOCIII ORF/cDNA clone-Adenovirus plasmid (BC027977)
Cat. No.: pGMAP000448
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human APOC3/APOCIII adenoviral expression plasmid for APOC3 adenovirus packaging, APOC3 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
APOC3/ApoCIII/APOC3/APOCIII products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAP000448 |
| Gene Name | APOC3 |
| Accession Number | BC027977 |
| Gene ID | 345 |
| Species | Human |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 300 bp |
| Gene Alias | APOCIII |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCAGCCCCGGGTACTCCTTGTTGTTGCCCTCCTGGCGCTCCTGGCCTCTGCCCGAGCTTCAGAGGCCGAGGATGCCTCCCTTCTCAGCTTCATGCAGGGTTACATGAAGCACGCCACCAAGACCGCCAAGGATGCACTGAGCAGCGTGCAGGAGTCCCAGGTGGCCCAGCAGGCCAGGGGCTGGGTGACCGATGGCTTCAGTTCCCTGAAAGACTACTGGAGCACCGTTAAGGACAAGTTCTCTGAGTTCTGGGATTTGGACCCTGAGGTCAGACCAACTTCAGCCGTGGCTGCCTGA |
| ORF Protein Sequence | MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T31518-Ab | Anti-APOC3/ ApoCIII/ APOCIII functional antibody |
| Target Antigen | GM-Tg-g-T31518-Ag | ApoCIII/APOC3 protein |
| ORF Viral Vector | pGMLP000502 | Human APOC3 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000448 | Human APOC3 Adenovirus plasmid |
| ORF Viral Vector | vGMLP000502 | Human APOC3 Lentivirus particle |
| ORF Viral Vector | vGMAP000448 | Human APOC3 Adenovirus particle |
Target information
| Target ID | GM-T31518 |
| Target Name | APOC3/ApoCIII |
|
Gene Group Identifier (Target Gene ID in Homo species) |
345 |
| Gene ID |
101080822 (Felis catus), 111774219 (Equus caballus), 11814 (Mus musculus), 24207 (Rattus norvegicus) 345 (Homo sapiens), 442970 (Canis lupus familiaris), 696726 (Macaca mulatta) |
| Gene Symbols & Synonyms | APOC3,Apoc3,Apo-CIII,ApoC-III,apo-CIII,apoC-III,Apo-C3,ApoC-3,APOCIII |
| Target Alternative Names | APOC3,APOCIII,Apo-C3,Apo-CIII,ApoC-3,ApoC-III,ApoCIII,Apoc3,Apolipoprotein C-III,Apolipoprotein C3,apo-CIII,apoC-III |
| Uniprot Accession |
P02656,P06759,P0DN28,P12279,P33622
Additional SwissProt Accessions: P0DN28,P33622,P06759,P02656,P12279 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | leukemia patients, Dent disease |
| Disease from KEGG | PPAR signaling pathway, Cholesterol metabolism |
| Gene Ensembl | ENSECAG00000039785, ENSMUSG00000032081, ENSG00000110245, ENSCAFG00845004284 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


