Human MDK/MK ORF/cDNA clone-Adenovirus plasmid (BC011704)
Cat. No.: pGMAP000446
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human MDK/MK adenoviral expression plasmid for MDK adenovirus packaging, MDK adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
Midkine/MDK/MDK/MK products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAP000446 |
Gene Name | MDK |
Accession Number | BC011704 |
Gene ID | 4192 |
Species | Human |
Product Type | Adenovirus plasmid (overexpression) |
Insert Length | 432 bp |
Gene Alias | MK |
Fluorescent Reporter | GFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCAGCACCGAGGCTTCCTCCTCCTCACCCTCCTCGCCCTGCTGGCGCTCACCTCCGCGGTCGCCAAAAAGAAAGATAAGGTGAAGAAGGGCGGCCCGGGGAGCGAGTGCGCTGAGTGGGCCTGGGGGCCCTGCACCCCCAGCAGCAAGGATTGCGGCGTGGGTTTCCGCGAGGGCACCTGCGGGGCCCAGACCCAGCGCATCCGGTGCAGGGTGCCCTGCAACTGGAAGAAGGAGTTTGGAGCCGACTGCAAGTACAAGTTTGAGAACTGGGGTGCGTGTGATGGGGGCACAGGCACCAAAGTCCGCCAAGGCACCCTGAAGAAGGCGCGCTACAATGCTCAGTGCCAGGAGACCATCCGCGTCACCAAGCCCTGCACCCCCAAGACCAAAGCAAAGGCCAAAGCCAAGAAAGGGAAGGGAAAGGACTAG |
ORF Protein Sequence | MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T03878-Ab | Anti-MK/ Midkine/ MDK functional antibody |
Target Antigen | GM-Tg-g-T03878-Ag | Midkine/MDK protein |
ORF Viral Vector | pGMLP000499 | Human MDK Lentivirus plasmid |
ORF Viral Vector | pGMAD001596 | Human MDK Adenovirus plasmid |
ORF Viral Vector | pGMAP000446 | Human MDK Adenovirus plasmid |
ORF Viral Vector | pGMAP000465 | Human MDK Adenovirus plasmid |
ORF Viral Vector | vGMLP000499 | Human MDK Lentivirus particle |
ORF Viral Vector | vGMAD001596 | Human MDK Adenovirus particle |
ORF Viral Vector | vGMAP000446 | Human MDK Adenovirus particle |
ORF Viral Vector | vGMAP000465 | Human MDK Adenovirus particle |
Target information
Target ID | GM-T03878 |
Target Name | Midkine/MDK |
Gene Group Identifier (Target Gene ID in Homo species) |
4192 |
Gene ID |
100147284 (Equus caballus), 101087941 (Felis catus), 119864230 (Canis lupus familiaris), 17242 (Mus musculus) 280852 (Bos taurus), 4192 (Homo sapiens), 714591 (Macaca mulatta), 81517 (Rattus norvegicus) |
Gene Symbols & Synonyms | MDK,Mdk,MK,Mek,ARAP,NEGF2 |
Target Alternative Names | Midkine, MDK,Midkine,MK,Amphiregulin-associated protein (ARAP), Midgestation and kidney protein, Neurite outgrowth-promoting factor 2, Neurite outgrowth-promoting protein,MK,ARAP,NEGF2 |
Uniprot Accession |
P12025,P21741,Q9R1S9
Additional SwissProt Accessions: P12025,P21741,Q9R1S9 |
Uniprot Entry Name | |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target |
Disease | Lung Cancer, Malignant neoplasm of bladder, Urinary bladder urothelial carcinoma, breast cancer |
Disease from KEGG | |
Gene Ensembl | ENSECAG00000029071, ENSCAFG00845028187, ENSMUSG00000027239, ENSBTAG00000007740, ENSG00000110492, ENSMMUG00000038138 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.