Human MDK/MK ORF/cDNA clone-Adenovirus plasmid (BC011704)

Cat. No.: pGMAP000446
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MDK/MK adenoviral expression plasmid for MDK adenovirus packaging, MDK adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to Midkine/MDK/MDK/MK products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000446
Gene Name MDK
Accession Number BC011704
Gene ID 4192
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 432 bp
Gene Alias MK
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGCACCGAGGCTTCCTCCTCCTCACCCTCCTCGCCCTGCTGGCGCTCACCTCCGCGGTCGCCAAAAAGAAAGATAAGGTGAAGAAGGGCGGCCCGGGGAGCGAGTGCGCTGAGTGGGCCTGGGGGCCCTGCACCCCCAGCAGCAAGGATTGCGGCGTGGGTTTCCGCGAGGGCACCTGCGGGGCCCAGACCCAGCGCATCCGGTGCAGGGTGCCCTGCAACTGGAAGAAGGAGTTTGGAGCCGACTGCAAGTACAAGTTTGAGAACTGGGGTGCGTGTGATGGGGGCACAGGCACCAAAGTCCGCCAAGGCACCCTGAAGAAGGCGCGCTACAATGCTCAGTGCCAGGAGACCATCCGCGTCACCAAGCCCTGCACCCCCAAGACCAAAGCAAAGGCCAAAGCCAAGAAAGGGAAGGGAAAGGACTAG
ORF Protein Sequence MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T03878-Ab Anti-MK/ Midkine/ MDK functional antibody
    Target Antigen GM-Tg-g-T03878-Ag Midkine/MDK protein
    ORF Viral Vector pGMLP000499 Human MDK Lentivirus plasmid
    ORF Viral Vector pGMAD001596 Human MDK Adenovirus plasmid
    ORF Viral Vector pGMAP000446 Human MDK Adenovirus plasmid
    ORF Viral Vector pGMAP000465 Human MDK Adenovirus plasmid
    ORF Viral Vector vGMLP000499 Human MDK Lentivirus particle
    ORF Viral Vector vGMAD001596 Human MDK Adenovirus particle
    ORF Viral Vector vGMAP000446 Human MDK Adenovirus particle
    ORF Viral Vector vGMAP000465 Human MDK Adenovirus particle


    Target information

    Target ID GM-T03878
    Target Name Midkine/MDK
    Gene Group Identifier
    (Target Gene ID in Homo species)
    4192
    Gene ID 100147284 (Equus caballus), 101087941 (Felis catus), 119864230 (Canis lupus familiaris), 17242 (Mus musculus)
    280852 (Bos taurus), 4192 (Homo sapiens), 714591 (Macaca mulatta), 81517 (Rattus norvegicus)
    Gene Symbols & Synonyms MDK,Mdk,MK,Mek,ARAP,NEGF2
    Target Alternative Names Midkine, MDK,Midkine,MK,Amphiregulin-associated protein (ARAP), Midgestation and kidney protein, Neurite outgrowth-promoting factor 2, Neurite outgrowth-promoting protein,MK,ARAP,NEGF2
    Uniprot Accession P12025,P21741,Q9R1S9
    Additional SwissProt Accessions: P12025,P21741,Q9R1S9
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Lung Cancer, Malignant neoplasm of bladder, Urinary bladder urothelial carcinoma, breast cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000029071, ENSCAFG00845028187, ENSMUSG00000027239, ENSBTAG00000007740, ENSG00000110492, ENSMMUG00000038138
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.