Human SERPINA1/A1A/A1AT ORF/cDNA clone-Adenovirus plasmid (BC011991)

Cat. No.: pGMAP000441
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SERPINA1/A1A/A1AT adenoviral expression plasmid for SERPINA1 adenovirus packaging, SERPINA1 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to Alpha 1 Antitrypsin/Alpha-1-antitrypsin/SERPINA1/SERPINA1/A1A products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000441
Gene Name SERPINA1
Accession Number BC011991
Gene ID 5265
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 1257 bp
Gene Alias A1A,A1AT,AAT,MGC23330,MGC9222,PI1,PRO2275
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGCCGTCTTCTGTCTCGTGGGGCATCCTCCTGCTGGCAGGCCTGTGCTGCCTGGTCCCTGTCTCCCTGGCTGAGGATCCCCAGGGAGATGCTGCCCAGAAGACAGATACATCCCACCATGATCAGGATCACCCAACCTTCAACAAGATCACCCCCAACCTGGCTGAGTTCGCCTTCAGCCTATACCGCCAGCTGGCACACCAGTCCAACAGCACCAATATCTTCTTCTCCCCAGTGAGCATCGCTACAGCCTTTGCAATGCTCTCCCTGGGGACCAAGGCTGACACTCACGATGAAATCCTGGAGGGCCTGAATTTCAACCTCACGGAGATTCCGGAGGCTCAGATCCATGAAGGCTTCCAGGAACTCCTCCGTACCCTCAACCAGCCAGACAGCCAGCTCCAGCTGACCACCGGCAATGGCTTGTTCCTCAGCGAGGGCCTGAAGCTAGTGGATAAGTTTTTGGAGGATGTTAAAAAGTTGTACCACTCAGAAGCCTTCACTGTCAACTTCGGGGACACCGAAGAGGCCAAGAAACAGATCAACGATTACGTGGAGAAGGGTACTCAAGGGAAAATTGTGGATTTGGTCAAGGAGCTTGACAGAGACACAGTTTTTGCTCTGGTGAATTACATCTTCTTTAAAGGCAAATGGGAGAGACCCTTTGAAGTCAAGGACACCGAGGAAGAGGACTTCCACGTGGACCAGGTGACCACCGTGAAGGTGCCTATGATGAAGCGTTTAGGCATGTTTAACATCCAGCACTGTAAGAAGCTGTCCAGCTGGGTGCTGCTGATGAAATACCTGGGCAATGCCACCGCCATCTTCTTCCTGCCTGATGAGGGGAAACTACAGCACCTGGAAAATGAACTCACCCACGATATCATCACCAAGTTCCTGGAAAATGAAGACAGAAGGTCTGCCAGCTTACATTTACCCAAACTGTCCATTACTGGAACCTATGATCTGAAGAGCGTCCTGGGTCAACTGGGCATCACTAAGGTCTTCAGCAATGGGGCTGACCTCTCCGGGGTCACAGAGGAGGCACCCCTGAAGCTCTCCAAGGCCGTGCATAAGGCTGTGCTGACCATCGACGAGAAAGGGACTGAAGCTGCTGGGGCCATGTTTTTAGAGGCCATACCCATGTCTATCCCCCCCGAGGTCAAGTTCAACAAACCCTTTGTCTTCTTAATGATTGACCAAAATACCAAGTCTCCCCTCTTCATGGGAAAAGTGGTGAATCCCACCCAAAAATAA
ORF Protein Sequence MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T28265-Ab Anti-A1AT/ SERPINA1/ A1A functional antibody
    Target Antigen GM-Tg-g-T28265-Ag SERPINA1 protein
    ORF Viral Vector pGMLP003894 Human SERPINA1 Lentivirus plasmid
    ORF Viral Vector pGMLV001493 Human SERPINA1 Lentivirus plasmid
    ORF Viral Vector pGMLV001572 Human SERPINA1 Lentivirus plasmid
    ORF Viral Vector pGMLV002164 Human SERPINA1 Lentivirus plasmid
    ORF Viral Vector pGMAAV000168 Human SERPINA1 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAP000441 Human SERPINA1 Adenovirus plasmid
    ORF Viral Vector vGMLP003894 Human SERPINA1 Lentivirus particle
    ORF Viral Vector vGMLV001493 Human SERPINA1 Lentivirus particle
    ORF Viral Vector vGMLV001572 Human SERPINA1 Lentivirus particle
    ORF Viral Vector vGMLV002164 Human SERPINA1 Lentivirus particle
    ORF Viral Vector vGMAAV000168 Human SERPINA1 Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAP000441 Human SERPINA1 Adenovirus particle


    Target information

    Target ID GM-T28265
    Target Name Alpha 1 Antitrypsin/Alpha-1-antitrypsin/SERPINA1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		5265
    Gene ID 24648 (Rattus norvegicus), 280699 (Bos taurus), 480422 (Canis lupus familiaris), 5265 (Homo sapiens)
    701361 (Macaca mulatta)
    Gene Symbols & Synonyms Serpina1,SERPINA1,Pi,AAT,Spi1,PI,A1A,PI1,A1AT,nNIF,PRO2275,alpha1AT
    Target Alternative Names A1A,A1AT,AAT,Alpha 1 Antitrypsin,Alpha-1 protease inhibitor,Alpha-1-antiproteinase,Alpha-1-antitrypsin,PI,PI1,PRO2275,Pi,SERPINA1,Serpin A1,Serpina1,Spi1,alpha1AT,nNIF
    Uniprot Accession P01009,P17475,P34955
    Additional SwissProt Accessions: P17475,P34955,P01009
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease cancer, Malignant neoplasm of bladder, IgA glomerulonephritis, Nephrotic syndrome with focal and segmental glomerular lesions, Diabetic Nephropathy, Contrast - Induced Nephropathy, Congenital occlusion of ureteropelvic junction, Calculus of kidney, Nephrotic syndrome, Acute pancreatitis, Juvenile arthritis, Urinary bladder urothelial carcinoma, Type 2 diabetes mellitus with diabetic nephropathy, protease
    Disease from KEGG Complement and coagulation cascades
    Gene Ensembl ENSBTAG00000018843, ENSCAFG00845002999, ENSG00000197249, ENSMMUG00000020426
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.