Human LALBA ORF/cDNA clone-Adenovirus plasmid (BC112316)

Cat. No.: pGMAP000430
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human LALBA/ adenoviral expression plasmid for LALBA adenovirus packaging, LALBA adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to LALBA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000430
Gene Name LALBA
Accession Number BC112316
Gene ID 3906
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 429 bp
Gene Alias
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGTTCTTTGTCCCTCTGTTCCTGGTGGGCATCCTGTTCCCTGCCATCCTGGCCAAGCAATTCACAAAATGTGAGCTGTCCCAGCTGCTGAAAGACATAGATGGTTATGGAGGCATCGCTTTGCCTGAATTGATCTGTACCATGTTTCACACCAGTGGTTATGACACACAAGCCATAGTTGAAAACAATGAAAGCACGGAATATGGACTCTTCCAGATCAGTAATAAGCTTTGGTGCAAGAGCAGCCAGGTCCCTCAGTCAAGGAACATCTGTGACATCTCCTGTGACAAGTTCCTGGATGATGACATTACTGATGACATAATGTGTGCCAAGAAGATCCTGGATATTAAAGGAATTGACTACTGGTTGGCCCATAAAGCCCTCTGCACTGAGAAGCTGGAACAGTGGCTTTGTGAGAAGTTGTGA
ORF Protein Sequence MRFFVPLFLVGILFPAILAKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T12938-Ab Anti-LALBA/ LYZG functional antibody
    Target Antigen GM-Tg-g-T12938-Ag LALBA protein
    ORF Viral Vector pGMAP000430 Human LALBA Adenovirus plasmid
    ORF Viral Vector vGMAP000430 Human LALBA Adenovirus particle


    Target information

    Target ID GM-T12938
    Target Name LALBA
    Gene Group Identifier
    （Target Gene ID in Homo species)         		3906
    Gene ID 100146585 (Equus caballus), 101090027 (Felis catus), 16770 (Mus musculus), 24528 (Rattus norvegicus)
    281894 (Bos taurus), 3906 (Homo sapiens), 403730 (Canis lupus familiaris), 707442 (Macaca mulatta)
    Gene Symbols & Synonyms LALBA,Lalba,LYZG,Lyzg,alfaLA,a-LACTA,HAMLET
    Target Alternative Names Alpha-lactalbumin,HAMLET,LALBA,LYZG,Lactose synthase B protein,Lalba,Lysozyme-like protein 7,Lyzg,a-LACTA,alfaLA
    Uniprot Accession P00709,P00711,P00714,P29752,P37154,Q9N2G9
    Additional SwissProt Accessions: P37154,P29752,P00714,P00711,P00709,Q9N2G9
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease breast cancer
    Disease from KEGG Metabolic pathways
    Gene Ensembl ENSECAG00000001401, ENSMUSG00000022991, ENSBTAG00000005859, ENSG00000167531, ENSCAFG00845025453, ENSMMUG00000000283
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.