Human FKBP1A/FKBP-12/FKBP12 ORF/cDNA clone-Adenovirus plasmid (BC119732)

Cat. No.: pGMAP000355
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FKBP1A/FKBP-12/FKBP12 adenoviral expression plasmid for FKBP1A adenovirus packaging, FKBP1A adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to FKBP1A/FKBP-12 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000355
Gene Name FKBP1A
Accession Number BC119732
Gene ID 2280
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 438 bp
Gene Alias FKBP-12,FKBP12,FKBP12C,PKC12,PKCI2,PPIASE
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCAGGCAACGCGCTGAGGGACTAGGCAGAGCCGTGGAACCGCCGCCAGGTCGCTGTTGGTCCACGCCGCCCGTCGCGCCGCCCGCCCGCTCAGCGTCCGCCGCCGCCATGGGAGTGCAGGTGGAAACCATCTCCCCAGGAGACGGGCGCACCTTCCCCAAGCGCGGCCAGACCTGCGTGGTGCACTACACCGGGATGCTTGAAGATGGAAAGAAATTTGATTCCTCCCGGGACAGAAACAAGCCCTTTAAGTTTATGCTAGGCAAGCAGGAGGTGATCCGAGGCTGGGAAGAAGGGGTTGCCCAGATGAGTGTGGGTCAGAGAGCCAAACTGACTATATCTCCAGATTATGCCTATGGTGCCACTGGGCACCCAGGCATCATCCCACCACATGCCACTCTCGTCTTCGATGTGGAGCTTCTAAAACTGGAATGA
ORF Protein Sequence MGRQRAEGLGRAVEPPPGRCWSTPPVAPPARSASAAAMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0019-Ab Anti-FKBP1A monoclonal antibody
    Target Antigen GM-Tg-g-IP0019-Ag FKBP1A protein
    ORF Viral Vector pGMLP000449 Human FKBP1A Lentivirus plasmid
    ORF Viral Vector pGMAP000355 Human FKBP1A Adenovirus plasmid
    ORF Viral Vector pGMAP000487 Human FKBP1A Adenovirus plasmid
    ORF Viral Vector vGMLP000449 Human FKBP1A Lentivirus particle
    ORF Viral Vector vGMAP000355 Human FKBP1A Adenovirus particle
    ORF Viral Vector vGMAP000487 Human FKBP1A Adenovirus particle


    Target information

    Target ID GM-IP0019
    Target Name FKBP1A
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2280
    Gene ID 100629541 (Equus caballus), 100686033 (Canis lupus familiaris), 101100379 (Felis catus), 14225 (Mus musculus)
    2280 (Homo sapiens), 25639 (Rattus norvegicus), 614795 (Bos taurus), 717385 (Macaca mulatta)
    Gene Symbols & Synonyms FKBP1A,Fkbp1a,Fkbp,Fkbp1,FKBP12,FKBP1,PKC12,PKCI2,PPIASE,FKBP-12,FKBP-1A,Fkbp2,FKBP1B
    Target Alternative Names FKBP1A,Peptidyl-prolyl cis-trans isomerase FKBP1A,PPIase FKBP1A,12 kDa FK506-binding protein (12 kDa FKBP, FKBP-12), Calstabin-1, FK506-binding protein 1A (FKBP-1A), Immunophilin FKBP12, Rotamase,FKBP1,PKC12,PKCI2,FKBP12,PPIASE,FKBP-12,FKBP-1A
    Uniprot Accession P18203,P26883,P62942,Q62658
    Additional SwissProt Accessions: P26883,P62942,Q62658,P18203
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000017887, ENSCAFG00845018977, ENSMUSG00000032966, ENSG00000088832, ENSBTAG00000008303, ENSMMUG00000015996
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.