Human MBP ORF/cDNA clone-Adenovirus plasmid (BC065248)

Cat. No.: pGMAP000256
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MBP/ adenoviral expression plasmid for MBP adenovirus packaging, MBP adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to Myelin basic protein/MBP/MBP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000256
Gene Name MBP
Accession Number BC065248
Gene ID 4155
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 594 bp
Gene Alias
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGGAAACCACGCAGGCAAACGAGAATTAAATGCCGAGAAGGCCAGTACGAATAGTGAAACTAACAGAGGAGAATCTGAAAAAAAGAGAAACCTGGGTGAACTTTCACGGACAACCTCAGAGGACAACGAAGTGTTCGGAGAGGCAGATGCGAACCAGAACAATGGGACCTCCTCTCAGGACACAGCGGTGACTGACTCCAAGCGCACAGCGGACCCGAAGAATGCCTGGCAGGATGCCCACCCAGCTGACCCAGGGAGCCGCCCCCACTTGATCCGCCTCTTTTCCCGAGATGCCCCGGGGAGGGAGGACAACACCTTCAAAGACAGGCCCTCTGAGTCCGACGAGCTCCAGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTGAGCTCTGAGGAGTAG
ORF Protein Sequence MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVSSEE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T54761-Ab Anti-MBP monoclonal antibody
    Target Antigen GM-Tg-g-T54761-Ag MBP VLP (virus-like particle)
    ORF Viral Vector pGMLP000535 Human MBP Lentivirus plasmid
    ORF Viral Vector pGMAP000256 Human MBP Adenovirus plasmid
    ORF Viral Vector vGMLP000535 Human MBP Lentivirus particle
    ORF Viral Vector vGMAP000256 Human MBP Adenovirus particle


    Target information

    Target ID GM-T54761
    Target Name Myelin basic protein/MBP
    Gene Group Identifier
    （Target Gene ID in Homo species)         		4155
    Gene ID 100063306 (Equus caballus), 101096421 (Felis catus), 17196 (Mus musculus), 24547 (Rattus norvegicus)
    4155 (Homo sapiens), 476160 (Canis lupus familiaris), 618684 (Bos taurus), 710350 (Macaca mulatta)
    Gene Symbols & Synonyms MBP,Mbp,jve,mld,shi,Hmbpr,golli-mbp,Mbps
    Target Alternative Names Hmbpr,MBP,Mbp,Mbps,Myelin A1 protein,Myelin basic protein,Myelin membrane encephalitogenic protein,golli-mbp,jve,mld,shi
    Uniprot Accession P02686,P02687,P02688,P04370,P83487
    Additional SwissProt Accessions: P83487,P04370,P02688,P02686,P02687
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Neuromuscular function, subclinical astrogliosis
    Disease from KEGG
    Gene Ensembl ENSECAG00000010961, ENSMUSG00000041607, ENSG00000197971, ENSCAFG00845000353, ENSBTAG00000022890, ENSMMUG00000011333
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.