Human MBP ORF/cDNA clone-Adenovirus plasmid (BC065248)
Cat. No.: pGMAP000256
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human MBP/ adenoviral expression plasmid for MBP adenovirus packaging, MBP adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
Myelin basic protein/MBP/MBP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAP000256 |
| Gene Name | MBP |
| Accession Number | BC065248 |
| Gene ID | 4155 |
| Species | Human |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 594 bp |
| Gene Alias | |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGGGAAACCACGCAGGCAAACGAGAATTAAATGCCGAGAAGGCCAGTACGAATAGTGAAACTAACAGAGGAGAATCTGAAAAAAAGAGAAACCTGGGTGAACTTTCACGGACAACCTCAGAGGACAACGAAGTGTTCGGAGAGGCAGATGCGAACCAGAACAATGGGACCTCCTCTCAGGACACAGCGGTGACTGACTCCAAGCGCACAGCGGACCCGAAGAATGCCTGGCAGGATGCCCACCCAGCTGACCCAGGGAGCCGCCCCCACTTGATCCGCCTCTTTTCCCGAGATGCCCCGGGGAGGGAGGACAACACCTTCAAAGACAGGCCCTCTGAGTCCGACGAGCTCCAGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTGAGCTCTGAGGAGTAG |
| ORF Protein Sequence | MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVSSEE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T54761-Ab | Anti-MBP monoclonal antibody |
| Target Antigen | GM-Tg-g-T54761-Ag | MBP VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000535 | Human MBP Lentivirus plasmid |
| ORF Viral Vector | pGMAP000256 | Human MBP Adenovirus plasmid |
| ORF Viral Vector | vGMLP000535 | Human MBP Lentivirus particle |
| ORF Viral Vector | vGMAP000256 | Human MBP Adenovirus particle |
Target information
| Target ID | GM-T54761 |
| Target Name | Myelin basic protein/MBP |
|
Gene Group Identifier (Target Gene ID in Homo species) |
4155 |
| Gene ID |
100063306 (Equus caballus), 101096421 (Felis catus), 17196 (Mus musculus), 24547 (Rattus norvegicus) 4155 (Homo sapiens), 476160 (Canis lupus familiaris), 618684 (Bos taurus), 710350 (Macaca mulatta) |
| Gene Symbols & Synonyms | MBP,Mbp,jve,mld,shi,Hmbpr,golli-mbp,Mbps |
| Target Alternative Names | Hmbpr,MBP,Mbp,Mbps,Myelin A1 protein,Myelin basic protein,Myelin membrane encephalitogenic protein,golli-mbp,jve,mld,shi |
| Uniprot Accession |
P02686,P02687,P02688,P04370,P83487
Additional SwissProt Accessions: P83487,P04370,P02688,P02686,P02687 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target |
| Disease | Neuromuscular function, subclinical astrogliosis |
| Disease from KEGG | |
| Gene Ensembl | ENSECAG00000010961, ENSMUSG00000041607, ENSG00000197971, ENSCAFG00845000353, ENSBTAG00000022890, ENSMMUG00000011333 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


