Human PDGFB/c-sis/PDGF2 ORF/cDNA clone-Adenovirus plasmid (BC029822)

Cat. No.: pGMAP000122
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PDGFB/c-sis/PDGF2 adenoviral expression plasmid for PDGFB adenovirus packaging, PDGFB adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to PDGF-BB/PDGFB/PDGFBB/PDGFB/c-sis products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000122
Gene Name PDGFB
Accession Number BC029822
Gene ID 5155
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 726 bp
Gene Alias c-sis,PDGF2,SSV
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGAATCGCTGCTGGGCGCTCTTCCTGTCTCTCTGCTGCTACCTGCGTCTGGTCAGCGCCGAGGGGGACCCCATTCCCGAGGAGCTTTATGAGATGCTGAGTGACCACTCGATCCGCTCCTTTGATGATCTCCAACGCCTGCTGCACGGAGACCCCGGAGAGGAAGATGGGGCCGAGTTGGACCTGAACATGACCCGCTCCCACTCTGGAGGCGAGCTGGAGAGCTTGGCTCGTGGAAGAAGGAGCCTGGGTTCCCTGACCATTGCTGAGCCGGCCATGATCGCCGAGTGCAAGACGCGCACCGAGGTGTTCGAGATCTCCCGGCGCCTCATAGACCGCACCAACGCCAACTTCCTGGTGTGGCCGCCCTGTGTGGAGGTGCAGCGCTGCTCCGGCTGCTGCAACAACCGCAACGTGCAGTGCCGCCCCACCCAGGTGCAGCTGCGACCTGTCCAGGTGAGAAAGATCGAGATTGTGCGGAAGAAGCCAATCTTTAAGAAGGCCACGGTGACGCTGGAAGACCACCTGGCATGCAAGTGTGAGACAGTGGCAGCTGCACGGCCTGTGACCCGAAGCCCGGGGGGTTCCCAGGAGCAGCGAGCCAAAACGCCCCAAACTCGGGTGACCATTCGGACGGTGCGAGTCCGCCGGCCCCCCAAGGGCAAGCACCGGAAATTCAAGCACACGCATGACAAGACGGCACTGAAGGAGACCCTTGGAGCCTAG
ORF Protein Sequence MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T87350-Ab Anti-PDGFB/ IBGC5/ PDGF-2 functional antibody
    Target Antigen GM-Tg-g-T87350-Ag PDGFB protein
    Cytokine cks-Tg-g-GM-T87350 platelet derived growth factor subunit B (PDGFB) protein & antibody
    ORF Viral Vector pGMAP000122 Human PDGFB Adenovirus plasmid
    ORF Viral Vector vGMAP000122 Human PDGFB Adenovirus particle


    Target information

    Target ID GM-T87350
    Target Name PDGF-BB/PDGFB/PDGFBB
    Gene Group Identifier
    （Target Gene ID in Homo species)         		5155
    Gene ID 100070283 (Equus caballus), 100135774 (Felis catus), 18591 (Mus musculus), 24628 (Rattus norvegicus)
    442986 (Canis lupus familiaris), 5155 (Homo sapiens), 540106 (Bos taurus), 703173 (Macaca mulatta)
    Gene Symbols & Synonyms PDGFB,Pdgfb,SIS,cis,PDGF,PDGF-2,Sis,c-sis,PDGF-B,SSV,IBGC5,PDGF2
    Target Alternative Names IBGC5,PDGF,PDGF subunit B,PDGF-2,PDGF-B,PDGF-BB,PDGF2,PDGFB,PDGFBB,Pdgfb,Platelet-derived growth factor B chain,Platelet-derived growth factor beta polypeptide,Platelet-derived growth factor subunit B,Proto-oncogene c-Sis,SIS,SSV,Sis,c-sis,cis
    Uniprot Accession P01127,P12919,P31240,Q05028,Q6Q7I7
    Additional SwissProt Accessions: P12919,P31240,Q05028,Q6Q7I7,P01127
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease cancer, Chronic Kidney Disease
    Disease from KEGG EGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Phospholipase D signaling pathway, PI3K-Akt signaling pathway, Focal adhesion, Gap junction, JAK-STAT signaling pathway, Regulation of actin cytoskeleton, Kaposi sarcoma-associated herpesvirus infection, Pathways in cancer, Renal cell carcinoma, Glioma, Prostate cancer, Melanoma, Choline metabolism in cancer, Fluid shear stress and atherosclerosis
    Gene Ensembl ENSECAG00000018472, ENSMUSG00000000489, ENSCAFG00845022039, ENSG00000100311, ENSBTAG00000021697, ENSMMUG00000002739
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.