Human FHIT/AP3Aase/FRA3B ORF/cDNA clone-Adenovirus plasmid (BC032336)

Cat. No.: pGMAP000114
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FHIT/AP3Aase/FRA3B adenoviral expression plasmid for FHIT adenovirus packaging, FHIT adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to FHIT/AP3Aase products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000114
Gene Name FHIT
Accession Number BC032336
Gene ID 2272
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 444 bp
Gene Alias AP3Aase,FRA3B
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGTCGTTCAGATTTGGCCAACATCTCATCAAGCCCTCTGTAGTGTTTCTCAAAACAGAACTGTCCTTCGCTCTTGTGAATAGGAAACCTGTGGTACCAGGACATGTCCTTGTGTGCCCGCTGCGGCCAGTGGAGCGCTTCCATGACCTGCGTCCTGATGAAGTGGCCGATTTGTTTCAGACGACCCAGAGAGTCGGGACAGTGGTGGAAAAACATTTCCATGGGACCTCTCTCACCTTTTCCATGCAGGATGGCCCCGAAGCCGGACAGACTGTGAAGCACGTTCACGTCCATGTTCTTCCCAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGGAGCTCCAGAAACATGACAAGGAGGACTTTCCTGCCTCTTGGAGATCAGAGGAGGAAATGGCAGCAGAAGCCGCAGCTCTGCGGGTCTACTTTCAGTGA
ORF Protein Sequence MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T59720-Ab Anti-FHIT/ AP3Aase/ FRA3B monoclonal antibody
    Target Antigen GM-Tg-g-T59720-Ag FHIT VLP (virus-like particle)
    ORF Viral Vector pGMAP000114 Human FHIT Adenovirus plasmid
    ORF Viral Vector vGMAP000114 Human FHIT Adenovirus particle


    Target information

    Target ID GM-T59720
    Target Name FHIT
    Gene Group Identifier
    （Target Gene ID in Homo species)         		2272
    Gene ID 100057165 (Equus caballus), 100215999 (Canis lupus familiaris), 101082731 (Felis catus), 14198 (Mus musculus)
    2272 (Homo sapiens), 60398 (Rattus norvegicus), 692183 (Bos taurus), 700974 (Macaca mulatta)
    Gene Symbols & Synonyms FHIT,Fhit,Fra14A2,FRA3B,AP3Aase
    Target Alternative Names 5'''-P1,AP3A hydrolase (AP3Aase),AP3Aase,Adenosine 5'-monophosphoramidase FHIT,Adenylylsulfatase,Adenylylsulfate-ammonia adenylyltransferase,Bis(5'-adenosyl)-triphosphatase,Diadenosine 5',Dinucleosidetriphosphatase,FHIT,FRA3B,Fhit,Fra14A2,Fragile histidine triad protein,P3-triphosphate hydrolase
    Uniprot Accession O89106,P49789,Q1KZG4,Q9JIX3
    Additional SwissProt Accessions: O89106,P49789,Q9JIX3,Q1KZG4
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease cancer, Lung Cancer
    Disease from KEGG Metabolic pathways, Small cell lung cancer, Non-small cell lung cancer
    Gene Ensembl ENSECAG00000049939, ENSCAFG00845017871, ENSMUSG00000060579, ENSG00000189283, ENSBTAG00000014418, ENSMMUG00000012832
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.