Human PCNA/MGC8367 ORF/cDNA clone-Adenovirus plasmid (BC000491)

Cat. No.: pGMAP000111
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PCNA/MGC8367 adenoviral expression plasmid for PCNA adenovirus packaging, PCNA adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to PCNA/MGC8367 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000111
Gene Name PCNA
Accession Number BC000491
Gene ID 5111
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 786 bp
Gene Alias MGC8367
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGTTCGAGGCGCGCCTGGTCCAGGGCTCCATCCTCAAGAAGGTGTTGGAGGCACTCAAGGACCTCATCAACGAGGCCTGCTGGGATATTAGCTCCAGCGGTGTAAACCTGCAGAGCATGGACTCGTCCCACGTCTCTTTGGTGCAGCTCACCCTGCGGTCTGAGGGCTTCGACACCTACCGCTGCGACCGCAACCTGGCCATGGGCGTGAACCTCACCAGTATGTCCAAAATACTAAAATGCGCCGGCAATGAAGATATCATTACACTAAGGGCCGAAGATAACGCGGATACCTTGGCGCTAGTATTTGAAGCACCAAACCAGGAGAAAGTTTCAGACTATGAAATGAAGTTGATGGATTTAGATGTTGAACAACTTGGAATTCCAGAACAGGAGTACAGCTGTGTAGTAAAGATGCCTTCTGGTGAATTTGCACGTATATGCCGAGATCTCAGCCATATTGGAGATGCTGTTGTAATTTCCTGTGCAAAAGACGGAGTGAAATTTTCTGCAAGTGGAGAACTTGGAAATGGAAACATTAAATTGTCACAGACAAGTAATGTCGATAAAGAGGAGGAAGCTGTTACCATAGAGATGAATGAACCAGTTCAACTAACTTTTGCACTGAGGTACCTGAACTTCTTTACAAAAGCCACTCCACTCTCTTCAACGGTGACACTCAGTATGTCTGCAGATGTACCCCTTGTTGTAGAGTATAAAATTGCGGATATGGGACACTTAAAATACTACTTGGCTCCCAAGATCGAGGATGAAGAAGGATCTTAG
ORF Protein Sequence MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T21782-Ab Anti-PCNA monoclonal antibody
    Target Antigen GM-Tg-g-T21782-Ag PCNA protein
    ORF Viral Vector pGMLV000281 Human PCNA Lentivirus plasmid
    ORF Viral Vector pGMLV000502 Human PCNA Lentivirus plasmid
    ORF Viral Vector pGMAP000111 Human PCNA Adenovirus plasmid
    ORF Viral Vector vGMLV000281 Human PCNA Lentivirus particle
    ORF Viral Vector vGMLV000502 Human PCNA Lentivirus particle
    ORF Viral Vector vGMAP000111 Human PCNA Adenovirus particle


    Target information

    Target ID GM-T21782
    Target Name PCNA
    Gene Group Identifier
    (Target Gene ID in Homo species)
    5111
    Gene ID 100052065 (Equus caballus), 101080704 (Felis catus), 18538 (Mus musculus), 25737 (Rattus norvegicus)
    477166 (Canis lupus familiaris), 5111 (Homo sapiens), 515499 (Bos taurus), 718006 (Macaca mulatta)
    Gene Symbols & Synonyms PCNA,Pcna,PCNAR,Pcna/cyclin,ATLD2
    Target Alternative Names PCNA,Proliferating cell nuclear antigen,PCNA,Cyclin,ATLD2
    Uniprot Accession P04961,P12004,P17918,Q3ZBW4
    Additional SwissProt Accessions: P17918,P04961,P12004,Q3ZBW4
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer, Aggressive angiomyxoma (AAM), breast cancer, Proliferation and growth regulation
    Disease from KEGG Tight junction, Hepatitis B
    Gene Ensembl ENSECAG00000013162, ENSMUSG00000027342, ENSCAFG00845028229, ENSG00000132646, ENSBTAG00000006065, ENSMMUG00000013259
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.