Human TRPM8/LTRPC6/MGC2849 ORF/cDNA clone-Adenovirus plasmid (BC001135.2)

Cat. No.: pGMAP000103
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TRPM8/LTRPC6/MGC2849 adenoviral expression plasmid for TRPM8 adenovirus packaging, TRPM8 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to TRPM8/LTRPC6 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000103
Gene Name TRPM8
Accession Number BC001135.2
Gene ID 79054
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 579 bp
Gene Alias LTRPC6,MGC2849,TRPP8
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGAAATCCTTCCTTCCTGTCCACACCATCGTGCTTATCAGGGAGAATGTGTGCAAGTGTGGCTATGCCCAGAGCCAGCACATGGAAGGCACCCAGATCAACCAAAGTGAGAAATGGAACTACAAGAAACACACCAAGGAATTTCCTACCGACGCCTTTGGGGATATTCAGTTTGAGACACTGGGGAAGAAAGGGAAGTATATACGTCTGTCCTGCGACACGGACGCGGAAATCCTTTACGAGCTGCTGACCCAGCACTGGCACCTGAAAACACCCAACCTGGTCATTTCTGTGACCGGGGGCGCCAAGAACTTCGCCCTGAAGCCGCGCATGCGCAAGATCTTCAGCCGGCTCATCTACATCGCGCAGTCCAAAGGTGCTTGGATTCTCACGGGAGGCACCCATTATGGCCTGATGAAGTACATCGGGGAGGTGGTGAGAGATAACACCATCAGCAGGAGTTCAGAGGAGAATATTGTGGCCATTGGCATAGCAGCTTGGGGCATGGTCTCCAACCGGGACACCCTCATCAGGAATTGCGATGCTGAGGTACCGGTGGGACAGGAGGAGGTCTGCTAG
ORF Protein Sequence MKSFLPVHTIVLIRENVCKCGYAQSQHMEGTQINQSEKWNYKKHTKEFPTDAFGDIQFETLGKKGKYIRLSCDTDAEILYELLTQHWHLKTPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWILTGGTHYGLMKYIGEVVRDNTISRSSEENIVAIGIAAWGMVSNRDTLIRNCDAEVPVGQEEVC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T41955-Ab Anti-TRPM8/ LTRPC6/ LTrpC-6 monoclonal antibody
    Target Antigen GM-Tg-g-T41955-Ag TRPM8 VLP (virus-like particle)
    ORF Viral Vector pGMLV002705 Human TRPM8 Lentivirus plasmid
    ORF Viral Vector pGMAP000103 Human TRPM8 Adenovirus plasmid
    ORF Viral Vector vGMLV002705 Human TRPM8 Lentivirus particle
    ORF Viral Vector vGMAP000103 Human TRPM8 Adenovirus particle


    Target information

    Target ID GM-T41955
    Target Name TRPM8
    Gene Group Identifier
    (Target Gene ID in Homo species)
    79054
    Gene ID 100057419 (Equus caballus), 100429414 (Macaca mulatta), 101101245 (Felis catus), 171382 (Mus musculus)
    171384 (Rattus norvegicus), 486170 (Canis lupus familiaris), 541151 (Bos taurus), 79054 (Homo sapiens)
    Gene Symbols & Synonyms TRPM8,Trpm8,CMR1,TRPP8,LTRPC6,Trp-p8,LTrpC-6,trp-p8
    Target Alternative Names CMR1,LTRPC6,LTrpC-6,LTrpC6),Long transient receptor potential channel 6 (LTrpC-6,TRPM8,TRPP8,Transient receptor potential cation channel subfamily M member 8,Transient receptor potential p8 (Trp-p8),Trp-p8,Trpm8,trp-p8
    Uniprot Accession Q7Z2W7,Q8R455,Q8R4D5
    Additional SwissProt Accessions: Q8R4D5,Q8R455,Q7Z2W7
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG Inflammatory mediator regulation of TRP channels
    Gene Ensembl ENSMMUG00000046155, ENSMUSG00000036251, ENSCAFG00845025630, ENSBTAG00000014652, ENSG00000144481
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.