Human COMT ORF/cDNA clone-Adenovirus plasmid (BC011935)
Cat. No.: pGMAP000064
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human COMT/ adenoviral expression plasmid for COMT adenovirus packaging, COMT adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
COMT products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAP000064 |
| Gene Name | COMT |
| Accession Number | BC011935 |
| Gene ID | 1312 |
| Species | Human |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 816 bp |
| Gene Alias | |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGCCGGAGGCCCCGCCTCTGCTGTTGGCAGCTGTGTTGCTGGGCCTGGTGCTGCTGGTGGTGCTGCTGCTGCTTCTGAGGCACTGGGGCTGGGGCCTGTGCCTTATCGGCTGGAACGAGTTCATCCTGCAGCCCATCCACAACCTGCTCATGGGTGACACCAAGGAGCAGCGCATCCTGAACCACGTGCTGCAGCATGCGGAGCCCGGGAACGCACAGAGCGTGCTGGAGGCCATTGACACCTACTGCGAGCAGAAGGAGTGGGCCATGAACGTGGGCGACAAGAAAGGCAAGATCGTGGACGCCGTGATTCAGGAGCACCAGCCCTCCGTGCTGCTGGAGCTGGGGGCCTACTGTGGCTACTCAGCTGTGCGCATGGCCCGCCTGCTGTCACCAGGGGCGAGGCTGATCACCATCGAGATCAACCCCGACTGTGCCGCCATCACCCAGCGGATGGTGGATTTCGCTGGCGTGAAGGACAAGGTCACCCTTGTGGTTGGAGCGTCCCAGGACATCATCCCCCAGCTGAAGAAGAAGTATGATGTGGACACACTGGACATGGTCTTCCTCGACCACTGGAAGGACCGGTACCTGCCGGACACGCTTCTCTTGGAGGAATGTGGCCTGCTGCGGAAGGGGACAGTGCTACTGGCTGACAACGTGATCTGCCCAGGTGCGCCAGACTTCCTAGCACACGTGCGCGGGAGCAGCTGCTTTGAGTGCACACACTACCAATCGTTCCTGGAATACAGGGAGGTGGTGGACGGCCTGGAGAAGGCCATCTACAAGGGCCCAGGCAGCGAAGCAGGGCCCTGA |
| ORF Protein Sequence | MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T76904-Ab | Anti-COMT/ HEL-S-98n monoclonal antibody |
| Target Antigen | GM-Tg-g-T76904-Ag | COMT VLP (virus-like particle) |
| ORF Viral Vector | pGMLP003872 | Human COMT Lentivirus plasmid |
| ORF Viral Vector | pGMAP000020 | Human COMT Adenovirus plasmid |
| ORF Viral Vector | pGMAP000064 | Human COMT Adenovirus plasmid |
| ORF Viral Vector | vGMLP003872 | Human COMT Lentivirus particle |
| ORF Viral Vector | vGMAP000020 | Human COMT Adenovirus particle |
| ORF Viral Vector | vGMAP000064 | Human COMT Adenovirus particle |
Target information
| Target ID | GM-T76904 |
| Target Name | COMT |
|
Gene Group Identifier (Target Gene ID in Homo species) |
1312 |
| Gene ID |
101097022 (Felis catus), 12846 (Mus musculus), 1312 (Homo sapiens), 24267 (Rattus norvegicus) 445450 (Canis lupus familiaris), 618278 (Bos taurus), 712548 (Macaca mulatta) |
| Gene Symbols & Synonyms | COMT,Comt,Comt1,D16Wsu103e,D330014B15Rik,HEL-S-98n |
| Target Alternative Names | COMT,Catechol O-methyltransferase,Comt,Comt1,D16Wsu103e,D330014B15Rik,HEL-S-98n |
| Uniprot Accession |
A7MBI7,O88587,P21964,P22734
Additional SwissProt Accessions: O88587,P21964,P22734,A7MBI7 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target |
| Disease | cancer, Malignant neoplasm of bladder, Schizophrenia |
| Disease from KEGG | Metabolic pathways, Steroid hormone biosynthesis |
| Gene Ensembl | ENSMUSG00000000326, ENSG00000093010, ENSCAFG00845028665, ENSBTAG00000019516, ENSMMUG00000054068 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


