Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
Plasmid quantity:
- 10mg, 50mg, 100mg, 500mg, >1g
Talk to our Expert:
- • Research Grade
- • Endotoxin-Free Grade
- • High Quality (HQ) Grade
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human CCL5/MGC17164/RANTES ORF/cDNA clone-Adenovirus plasmid (BC008600)
Cat. No.: pGMAP000062
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CCL5/MGC17164/RANTES adenoviral expression plasmid for CCL5 adenovirus packaging, CCL5 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Datasheet
Go to
RANTES/CCL5/CCL5/MGC17164 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAP000062 |
| Gene Name | CCL5 |
| Accession Number | BC008600 |
| Gene ID | 6352 |
| Species | Human |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 276 bp |
| Gene Alias | MGC17164,RANTES,SISd,TCP228 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGAAGGTCTCCGCGGCAGCCCTCGCTGTCATCCTCATTGCTACTGCCCTCTGCGCTCCTGCATCTGCCTCCCCATATTCCTCGGACACCACACCCTGCTGCTTTGCCTACATTGCCCGCCCACTGCCCCGTGCCCACATCAAGGAGTATTTCTACACCAGTGGCAAGTGCTCCAACCCAGCAGTCGTCTTTGTCACCCGAAAGAACCGCCAAGTGTGTGCCAACCCAGAGAAGAAATGGGTTCGGGAGTACATCAACTCTTTGGAGATGAGCTAG |
| ORF Protein Sequence | MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T16263-Ab | Anti-CCL5/ D17S136E/ RANTES functional antibody |
| Target Antigen | GM-Tg-g-T16263-Ag | CCL5 protein |
| Cytokine | cks-Tg-g-GM-T16263 | chemokine (C-C motif) ligand 5 (CCL5) protein & antibody |
| ORF Viral Vector | pGMLV001580 | Human CCL5 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001626 | Human CCL5 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001699 | Human CCL5 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001882 | Human CCL5 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000013 | Human CCL5 Adenovirus plasmid |
| ORF Viral Vector | pGMAP000062 | Human CCL5 Adenovirus plasmid |
| ORF Viral Vector | pGMPC000787 | Human CCL5 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLV001580 | Human CCL5 Lentivirus particle |
| ORF Viral Vector | vGMLV001626 | Human CCL5 Lentivirus particle |
| ORF Viral Vector | vGMLV001699 | Human CCL5 Lentivirus particle |
| ORF Viral Vector | vGMLV001882 | Human CCL5 Lentivirus particle |
| ORF Viral Vector | vGMAP000013 | Human CCL5 Adenovirus particle |
| ORF Viral Vector | vGMAP000062 | Human CCL5 Adenovirus particle |
Target information
| Target ID | GM-T16263 |
| Target Name | RANTES/CCL5 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
6352 |
| Gene ID |
100033925 (Equus caballus), 20304 (Mus musculus), 327712 (Bos taurus), 403522 (Canis lupus familiaris) 493689 (Felis catus), 574178 (Macaca mulatta), 6352 (Homo sapiens), 81780 (Rattus norvegicus) |
| Gene Symbols & Synonyms | CCL5,Ccl5,SCYA5,RANTES,SISd,Scya5,TCP228,MuRantes,eoCP,D17S136E,SIS-delta,Rantes |
| Target Alternative Names | C-C motif chemokine 5,CCL5,Ccl5,D17S136E,EoCP,Eosinophil chemotactic cytokine,MuRantes,RANTES,Rantes,SCYA5,SIS-delta,SISd,Scya5,Small-inducible cytokine A5,T cell-specific protein P228 (TCP228),T-cell-specific protein RANTES,TCP228,eoCP |
| Uniprot Accession |
O97919,P13501,P30882,P50231,Q8HYQ1,Q8HYS0,Q8MKD0,Q8SQ40
Additional SwissProt Accessions: Q8MKD0,P30882,O97919,Q8HYS0,Q8SQ40,Q8HYQ1,P13501,P50231 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Cytokine Target |
| Disease | cancer, Breast Cancer, Type 1 diabetes mellitus, Chronic Kidney Disease |
| Disease from KEGG | Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, TNF signaling pathway, Epithelial cell signaling in Helicobacter pylori infection, Chagas disease, Human cytomegalovirus infection, Influenza A, Rheumatoid arthritis, Lipid and atherosclerosis |
| Gene Ensembl | ENSMUSG00000035042, ENSBTAG00000066072, ENSMMUG00000054796, ENSG00000271503 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.