Human IL1RN/ICIL-1RA/IL-1ra3 ORF/cDNA clone-Adenovirus plasmid (BC009745)

Cat. No.: pGMAP000045
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL1RN/ICIL-1RA/IL-1ra3 adenoviral expression plasmid for IL1RN adenovirus packaging, IL1RN adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to IL-1RA/IL1RN/IL1RN/ICIL-1RA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000045
Gene Name IL1RN
Accession Number BC009745
Gene ID 3557
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 480 bp
Gene Alias ICIL-1RA,IL-1ra3,IL1F3,IL1RA,IRAP,MGC10430
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGCTTTAGAGACGATCTGCCGACCCTCTGGGAGAAAATCCAGCAAGATGCAAGCCTTCAGAATCTGGGATGTTAACCAGAAGACCTTCTATCTGAGGAACAACCAACTAGTTGCCGGATACTTGCAAGGACCAAATGTCAATTTAGAAGAAAAGATAGATGTGGTACCCATTGAGCCTCATGCTCTGTTCTTGGGAATCCATGGAGGGAAGATGTGCCTGTCCTGTGTCAAGTCTGGTGATGAGACCAGACTCCAGCTGGAGGCAGTTAACATCACTGACCTGAGCGAGAACAGAAAGCAGGACAAGCGCTTCGCCTTCATCCGCTCAGACAGTGGCCCCACCACCAGTTTTGAGTCTGCCGCCTGCCCCGGTTGGTTCCTCTGCACAGCGATGGAAGCTGACCAGCCCGTCAGCCTCACCAATATGCCTGACGAAGGCGTCATGGTCACCAAATTCTACTTCCAGGAGGACGAGTAG
ORF Protein Sequence MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2544-Ab Anti-IL1RA/ IL1RN/ DIRA monoclonal antibody
    Target Antigen GM-Tg-g-MP2544-Ag IL1RN VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-MP2544 interleukin 1 receptor antagonist (IL1RN) protein & antibody
    ORF Viral Vector pGMLP000397 Human IL1RN Lentivirus plasmid
    ORF Viral Vector pGMAP000045 Human IL1RN Adenovirus plasmid
    ORF Viral Vector pGMLP-IL-004 Human IL1RN Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-087 Human IL1RN Adenovirus plasmid
    ORF Viral Vector vGMLP000397 Human IL1RN Lentivirus particle
    ORF Viral Vector vGMAP000045 Human IL1RN Adenovirus particle
    ORF Viral Vector vGMLP-IL-004 Human IL1RN Lentivirus particle
    ORF Viral Vector vGMAP-IL-087 Human IL1RN Adenovirus particle


    Target information

    Target ID GM-MP2544
    Target Name IL-1RA/IL1RN
    Gene Group Identifier
    （Target Gene ID in Homo species)         		3557
    Gene ID 100034236 (Equus caballus), 16181 (Mus musculus), 281860 (Bos taurus), 3557 (Homo sapiens)
    403660 (Canis lupus familiaris), 60582 (Rattus norvegicus), 701658 (Macaca mulatta)
    Gene Symbols & Synonyms IL1RN,Il1rn,IL-1RA,IL-1ra,F630041P17Rik,DIRA,IRAP,CRMO2,IL1F3,IL1RA,MVCD4,IL-1RN,IL-1ra3,ICIL-1RA,Il1ra
    Target Alternative Names CRMO2,DIRA,F630041P17Rik,ICIL-1RA,IL-1RA,IL-1RN,IL-1ra,IL-1ra3,IL1 inhibitor,IL1F3,IL1RA,IL1RN,IRAP,Il1ra,Il1rn,Interleukin-1 receptor antagonist protein,MVCD4
    Uniprot Accession O18999,O77482,P18510,P25085,P25086,Q9BEH0
    Additional SwissProt Accessions: O18999,P25085,O77482,P18510,Q9BEH0,P25086
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Cytokine Target
    Disease cancer
    Disease from KEGG Cytokine-cytokine receptor interaction
    Gene Ensembl ENSMUSG00000026981, ENSBTAG00000019665, ENSG00000136689, ENSCAFG00845011971, ENSMMUG00000013014
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.