Human APOA1 ORF/cDNA clone-Adenovirus plasmid (BC005380)
Cat. No.: pGMAP000043
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human APOA1/ adenoviral expression plasmid for APOA1 adenovirus packaging, APOA1 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
Apolipoprotein AI/APOA1/APOA1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAP000043 |
| Gene Name | APOA1 |
| Accession Number | BC005380 |
| Gene ID | 335 |
| Species | Human |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 804 bp |
| Gene Alias | |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGAAAGCTGCGGTGCTGACCTTGGCCGTGCTCTTCCTGACGGGGAGCCAGGCTCGGCATTTCTGGCAGCAAGATGAACCCCCCCAGAGCCCCTGGGATCGAGTGAAGGACCTGGCCACTGTGTACGTGGATGTGCTCAAAGACAGCGGCAGAGACTATGTGTCCCAGTTTGAAGGCTCCGCCTTGGGAAAACAGCTAAACCTAAAGCTCCTTGACAACTGGGACAGCGTGACCTCCACCTTCAGCAAGCTGCGCGAACAGCTCGGCCCTGTGACCCAGGAGTTCTGGGATAACCTGGAAAAGGAGACAGAGGGCCTGAGGCAGGAGATGAGCAAGGATCTGGAGGAGGTGAAGGCCAAGGTGCAGCCCTACCTGGACGACTTCCAGAAGAAGTGGCAGGAGGAGATGGAGCTCTACCGCCAGAAGGTGGAGCCGCTGCGCGCAGAGCTCCAAGAGGGCGCGCGCCAGAAGCTGCACGAGCTGCAAGAGAAGCTGAGCCCACTGGGCGAGGAGATGCGCGACCGCGCGCGCGCCCATGTGGACGCGCTGCGCACGCATCTGGCCCCCTACAGCGACGAGCTGCGCCAGCGCTTGGCCGCGCGCCTTGAGGCTCTCAAGGAGAACGGCGGCGCCAGACTGGCCGAGTACCACGCCAAGGCCACCGAGCATCTGAGCACGCTCAGCGAGAAGGCCAAGCCCGCGCTCGAGGACCTCCGCCAAGGCCTGCTGCCCGTGCTGGAGAGCTTCAAGGTCAGCTTCCTGAGCGCTCTCGAGGAGTACACTAAGAAGCTCAACACCCAGTGA |
| ORF Protein Sequence | MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T56545-Ab | Anti-APOA1/ apo(a) monoclonal antibody |
| Target Antigen | GM-Tg-g-T56545-Ag | APOA1 VLP (virus-like particle) |
| ORF Viral Vector | pGMAAV001259 | Human APOA1 Adeno-associate virus(AAV) plasmid |
| ORF Viral Vector | pGMAP000043 | Human APOA1 Adenovirus plasmid |
| ORF Viral Vector | pGMPC000928 | Human APOA1 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMAAV001259 | Human APOA1 Adeno-associate virus(AAV) particle |
| ORF Viral Vector | vGMAP000043 | Human APOA1 Adenovirus particle |
Target information
| Target ID | GM-T56545 |
| Target Name | Apolipoprotein AI/APOA1 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
335 |
| Gene ID |
100062583 (Equus caballus), 101081076 (Felis catus), 11806 (Mus musculus), 25081 (Rattus norvegicus) 281631 (Bos taurus), 335 (Homo sapiens), 479427 (Canis lupus familiaris), 696969 (Macaca mulatta) |
| Gene Symbols & Synonyms | APOA1,Apoa1,Sep2,Alp-1,Ltw-1,Sep-1,Sep-2,Apoa-1,Brp-14,Lvtw-1,apo-AI,apoA-I,AMYLD3,HPALP2,apo(a),Apo-AI,ApoA-I |
| Target Alternative Names | AMYLD3,APOA1,Alp-1,Apo-AI,ApoA-I,Apoa-1,Apoa1,Apolipoprotein A-I,Apolipoprotein A1,Apolipoprotein AI,Brp-14,HPALP2,Ltw-1,Lvtw-1,Sep-1,Sep-2,Sep2,apo(a),apo-AI,apoA-I |
| Uniprot Accession |
F7FQM7,P02647,P02648,P04639,P15497,Q00623
Additional SwissProt Accessions: Q00623,P04639,P15497,P02647,P02648,F7FQM7 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target |
| Disease | Ovary Cancer, Ovarian Cancer, Malignant neoplasm of bladder, Nephrotic syndrome, Nephrotic syndrome with focal and segmental glomerular lesions, Type 1 diabetes mellitus, Dent disease, Diabetic Nephropathy |
| Disease from KEGG | PPAR signaling pathway, Fat digestion and absorption, Vitamin digestion and absorption, Cholesterol metabolism, African trypanosomiasis, Lipid and atherosclerosis |
| Gene Ensembl | ENSECAG00000009752, ENSMUSG00000032083, ENSBTAG00000065859, ENSG00000118137, ENSCAFG00845004266, ENSMMUG00000044545 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


