Human CD14 ORF/cDNA clone-Adenovirus plasmid (BC010507)

Cat. No.: pGMAP000007
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CD14/ adenoviral expression plasmid for CD14 adenovirus packaging, CD14 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to CD14 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000007
Gene Name CD14
Accession Number BC010507
Gene ID 929
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 1128 bp
Gene Alias
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGAGCGCGCGTCCTGCTTGTTGCTGCTGCTGCTGCCGCTGGTGCACGTCTCTGCGACCACGCCAGAACCTTGTGAGCTGGACGATGAAGATTTCCGCTGCGTCTGCAACTTCTCCGAACCTCAGCCCGACTGGTCCGAAGCCTTCCAGTGTGTGTCTGCAGTAGAGGTGGAGATCCATGCCGGCGGTCTCAACCTAGAGCCGTTTCTAAAGCGCGTCGATGCGGACGCCGACCCGCGGCAGTATGCTGACACGGTCAAGGCTCTCCGCGTGCGGCGGCTCACAGTGGGAGCCGCACAGGTTCCTGCTCAGCTACTGGTAGGCGCCCTGCGTGTGCTAGCGTACTCCCGCCTCAAGGAACTGACGCTCGAGGACCTAAAGATAACCGGCACCATGCCTCCGCTGCCTCTGGAAGCCACAGGACTTGCACTTTCCAGCTTGCGCCTACGCAACGTGTCGTGGGCGACAGGGCGTTCTTGGCTCGCCGAGCTGCAGCAGTGGCTCAAGCCAGGCCTCAAGGTACTGAGCATTGCCCAAGCACACTCGCCTGCCTTTTCCTGCGAACAGGTTCGCGCCTTCCCGGCCCTTACCAGCCTAGACCTGTCTGACAATCCTGGACTGGGCGAACGCGGACTGATGGCGGCTCTCTGTCCCCACAAGTTCCCGGCCATCCAGAATCTAGCGCTGCGCAACACAGGAATGGAGACGCCCACAGGCGTGTGCGCCGCACTGGCGGCGGCAGGTGTGCAGCCCCACAGCCTAGACCTCAGCCACAACTCGCTGCGCGCCACCGTAAACCCTAGCGCTCCGAGATGCATGTGGTCCAGCGCCCTGAACTCCCTCAATCTGTCGTTCGCTGGGCTGGAACAGGTGCCTAAAGGACTGCCAGCCAAGCTCAGAGTGCTCGATCTCAGCTGCAACAGACTGAACAGGGCGCCGCAGCCTGACGAGCTGCCCGAGGTGGATAACCTGACACTGGACGGGAATCCCTTCCTGGTCCCTGGAACTGCCCTCCCCCACGAGGGCTCAATGAACTCCGGCGTGGTCCCAGCCTGTGCACGTTCGACCCTGTCGGTGGGGGTGTCGGGAACCCTGGTGCTGCTCCAAGGGGCCCGGGGCTTTGCCTAA
ORF Protein Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-035 Pre-Made Atibuclimab biosimilar, Whole Mab: Anti-CD14 therapeutic antibody
    Target Antibody GM-Tg-g-T23212-Ab Anti-CD14 monoclonal antibody
    Target Antigen GM-Tg-g-T23212-Ag CD14 VLP (virus-like particle)
    ORF Viral Vector pGMLP000492 Human CD14 Lentivirus plasmid
    ORF Viral Vector pGMAP000007 Human CD14 Adenovirus plasmid
    ORF Viral Vector vGMLP000492 Human CD14 Lentivirus particle
    ORF Viral Vector vGMAP000007 Human CD14 Adenovirus particle


    Target information

    Target ID GM-T23212
    Target Name CD14
    Gene Group Identifier
    (Target Gene ID in Homo species)
    929
    Gene ID 101096132 (Felis catus), 12475 (Mus musculus), 281048 (Bos taurus), 60350 (Rattus norvegicus)
    607076 (Canis lupus familiaris), 697482 (Macaca mulatta), 929 (Homo sapiens)
    Gene Symbols & Synonyms CD14,Cd14
    Target Alternative Names CD14,Monocyte differentiation antigen CD14,My23 antigen, Myeloid cell-specific leucine-rich glycoprotein
    Uniprot Accession P08571,P10810,Q63691,Q95122
    Additional SwissProt Accessions: P10810,Q95122,Q63691,P08571
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, INN Index
    Disease cancer, Kidney transplant rejection, Congenital occlusion of ureteropelvic junction
    Disease from KEGG MAPK signaling pathway, NF-kappa B signaling pathway, Phagosome, Toll-like receptor signaling pathway, Hematopoietic cell lineage, Alcoholic liver disease, Pertussis, Legionellosis, Amoebiasis, Tuberculosis, Acute myeloid leukemia, Lipid and atherosclerosis
    Gene Ensembl ENSMUSG00000051439, ENSBTAG00000015032, ENSCAFG00845001909, ENSMMUG00000010007, ENSG00000170458
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.