Human TOMM20/MAS20/MOM19 ORF/cDNA clone-Adenovirus plasmid (NM_014765)
Cat. No.: pGMAP-atg-081
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human TOMM20/MAS20/MOM19 adenoviral expression plasmid for TOMM20 adenovirus packaging, TOMM20 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
TOMM20/MAS20 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAP-atg-081 |
Gene Name | TOMM20 |
Accession Number | NM_014765 |
Gene ID | 9804 |
Species | Human |
Product Type | Adenovirus plasmid (overexpression) |
Insert Length | 438 bp |
Gene Alias | MAS20,MOM19,TOM20 |
Fluorescent Reporter | EGFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGTGGGTCGGAACAGCGCCATCGCCGCCGGTGTATGCGGGGCCCTTTTCATTGGGTACTGCATCTACTTCGACCGCAAAAGACGAAGTGACCCCAACTTCAAGAACAGGCTTCGAGAACGAAGAAAGAAACAGAAGCTTGCCAAGGAGAGAGCTGGGCTTTCCAAGTTACCTGACCTTAAAGATGCTGAAGCTGTTCAGAAGTTCTTCCTTGAAGAAATACAGCTTGGTGAAGAGTTACTAGCTCAAGGTGAATATGAGAAGGGCGTAGACCATCTGACAAATGCAATTGCTGTGTGTGGACAGCCACAGCAGTTACTGCAGGTCTTACAGCAAACTCTTCCACCACCAGTGTTCCAGATGCTTCTGACTAAGCTCCCAACAATTAGTCAGAGAATTGTAAGTGCTCAGAGCTTGGCTGAAGATGATGTGGAATGA |
ORF Protein Sequence | MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP2158-Ab | Anti-TOMM20 monoclonal antibody |
Target Antigen | GM-Tg-g-IP2158-Ag | TOMM20 protein |
ORF Viral Vector | pGMLP000081 | Human TOMM20 Lentivirus plasmid |
ORF Viral Vector | pGMAD000693 | Human TOMM20 Adenovirus plasmid |
ORF Viral Vector | pGMAD000830 | Human TOMM20 Adenovirus plasmid |
ORF Viral Vector | pGMLP-atg-027 | Human TOMM20 Lentivirus plasmid |
ORF Viral Vector | pGMAP-atg-081 | Human TOMM20 Adenovirus plasmid |
ORF Viral Vector | pGMLP-SPh-098 | Human TOMM20 Lentivirus plasmid |
ORF Viral Vector | pGMAP-SPh-238 | Human TOMM20 Adenovirus plasmid |
ORF Viral Vector | pGMPC001617 | Human TOMM20 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP000081 | Human TOMM20 Lentivirus particle |
ORF Viral Vector | vGMAD000693 | Human TOMM20 Adenovirus particle |
ORF Viral Vector | vGMAD000830 | Human TOMM20 Adenovirus particle |
ORF Viral Vector | vGMLP-atg-027 | Human TOMM20 Lentivirus particle |
ORF Viral Vector | vGMAP-atg-081 | Human TOMM20 Adenovirus particle |
ORF Viral Vector | vGMLP-SPh-098 | Human TOMM20 Lentivirus particle |
ORF Viral Vector | vGMAP-SPh-238 | Human TOMM20 Adenovirus particle |
Target information
Target ID | GM-IP2158 |
Target Name | TOMM20 |
Gene Group Identifier (Target Gene ID in Homo species) |
9804 |
Gene ID |
100058806 (Equus caballus), 100682999 (Canis lupus familiaris), 101082695 (Felis catus), 266601 (Rattus norvegicus) 67952 (Mus musculus), 712039 (Macaca mulatta), 781575 (Bos taurus), 9804 (Homo sapiens) |
Gene Symbols & Synonyms | TOMM20,Tomm20,MAS20,MOM19,TOM20,Gm19268,mKIAA0016,1810060K07Rik |
Target Alternative Names | TOMM20,Mitochondrial import receptor subunit TOM20 homolog,Mitochondrial 20 kDa outer membrane protein, Outer mitochondrial membrane receptor Tom20,MAS20,MOM19,TOM20 |
Uniprot Accession |
A6H7B1,Q15388,Q62760,Q9DCC8
Additional SwissProt Accessions: Q62760,Q9DCC8,A6H7B1,Q15388 |
Uniprot Entry Name | |
Protein Sub-location | Introcelluar Protein |
Category | |
Disease | |
Disease from KEGG | |
Gene Ensembl | ENSCAFG00845003534, ENSMUSG00000093904, ENSMMUG00000058824, ENSBTAG00000000562, ENSG00000173726 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.