Human FIS1/CGI-135/TTC11 ORF/cDNA clone-Adenovirus plasmid (NM_016068)
Cat. No.: pGMAP-SPh-233
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human FIS1/CGI-135/TTC11 adenoviral expression plasmid for FIS1 adenovirus packaging, FIS1 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
FIS1/CGI-135 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAP-SPh-233 |
Gene Name | FIS1 |
Accession Number | NM_016068 |
Gene ID | 51024 |
Species | Human |
Product Type | Adenovirus plasmid (overexpression) |
Insert Length | 459 bp |
Gene Alias | CGI-135,TTC11 |
Fluorescent Reporter | EGFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGAGGCCGTGCTGAACGAGCTGGTGTCTGTGGAGGACCTGCTGAAGTTTGAAAAGAAATTTCAGTCTGAGAAGGCAGCAGGCTCGGTGTCCAAGAGCACGCAGTTTGAGTACGCCTGGTGCCTGGTGCGGAGCAAGTACAATGATGACATCCGTAAAGGCATCGTGCTGCTCGAGGAGCTGCTGCCCAAAGGGAGCAAGGAGGAACAGCGGGATTACGTCTTCTACCTGGCCGTGGGGAACTACCGGCTCAAGGAATACGAGAAGGCCTTAAAGTACGTCCGCGGGTTGCTGCAGACAGAGCCCCAGAACAACCAGGCCAAGGAACTGGAGCGGCTCATTGACAAGGCCATGAAGAAAGATGGACTCGTGGGCATGGCCATCGTGGGAGGCATGGCCCTGGGTGTGGCGGGACTGGCCGGACTCATCGGACTTGCTGTGTCCAAGTCCAAATCCTGA |
ORF Protein Sequence | MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP0847-Ab | Anti-FIS1 monoclonal antibody |
Target Antigen | GM-Tg-g-IP0847-Ag | FIS1 protein |
ORF Viral Vector | pGMLP002675 | Human FIS1 Lentivirus plasmid |
ORF Viral Vector | pGMAD000275 | Human FIS1 Adenovirus plasmid |
ORF Viral Vector | pGMLP-SPh-093 | Human FIS1 Lentivirus plasmid |
ORF Viral Vector | pGMAP-SPh-233 | Human FIS1 Adenovirus plasmid |
ORF Viral Vector | vGMLP002675 | Human FIS1 Lentivirus particle |
ORF Viral Vector | vGMAD000275 | Human FIS1 Adenovirus particle |
ORF Viral Vector | vGMLP-SPh-093 | Human FIS1 Lentivirus particle |
ORF Viral Vector | vGMAP-SPh-233 | Human FIS1 Adenovirus particle |
Target information
Target ID | GM-IP0847 |
Target Name | FIS1 |
Gene Group Identifier (Target Gene ID in Homo species) |
51024 |
Gene ID |
100059592 (Equus caballus), 101081944 (Felis catus), 288584 (Rattus norvegicus), 479728 (Canis lupus familiaris) 51024 (Homo sapiens), 615565 (Bos taurus), 66437 (Mus musculus), 714444 (Macaca mulatta) |
Gene Symbols & Synonyms | FIS1,Fis1,Ttc11,TTC11,CGI-135,2010003O14Rik |
Target Alternative Names | FIS1,Mitochondrial fission 1 protein,FIS1 homolog (hFis1), Tetratricopeptide repeat protein 11 (TPR repeat protein 11),TTC11,CGI-135 |
Uniprot Accession |
P84817,Q3T0I5,Q9CQ92,Q9Y3D6
Additional SwissProt Accessions: P84817,Q9Y3D6,Q3T0I5,Q9CQ92 |
Uniprot Entry Name | |
Protein Sub-location | Introcelluar Protein |
Category | |
Disease | |
Disease from KEGG | |
Gene Ensembl | ENSECAG00000013191, ENSCAFG00845005056, ENSG00000214253, ENSMUSG00000019054, ENSMMUG00000052148 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.